Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Alpha trans-inducing factor 74 kDa protein Recombinant Protein | ORF12 recombinant protein

Recombinant Varicella-zoster virus Alpha trans-inducing factor 74 kDa protein (ORF12)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha trans-inducing factor 74 kDa protein; Recombinant Varicella-zoster virus Alpha trans-inducing factor 74 kDa protein (ORF12); ORF12 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-661aa; full length protein
Sequence
MFSRFARSFSSDDRTRKSYDGSYQSFNAGERDLPTPTRDWCSISQRITSERVRDGCLIPT PGEALETAVKALSEKTDSLTSPVLQSTERHSVLLGLHHNNVPESLVVSCMSNDVHDGFMQ RYMETIQRCLDDLKLSGDGLWWVYENTYWQYLKYTTGAEVPVTSEKVNKKSKSTVLLFSS VVANKPISRHPFKSKVINSDYRGICQELREALGAVQKYMYFMRPDDPTNPSPDTRIRVQE IAAYTATGYGWMLWFLDVVDARVCRHLKLQFRRIRGPRASVIPDDLLRRHLKTGPAVSAG TGVAFILAATTASALTALLRISVLWRKEEWRDGLNGTAAAIVAAVELITLLHHHFQYLIN MMLIGYACWGDGGLNDPYILKALRAQGRFLYFAGQLVRTMSTHSWVVLETSTHMWFSRAV AQSILAHGGKPTKYYAQVLAASKRYTPLHLRRISEPSSVSDQPYIRFNRLGSPIGTGIGN LECVCLTGNYLSDDVNASSHVINTEAPLNSIAPDTNRQRTSRVLVRPDTGLDVTVRKNHC LDIGHTDGSPVDPTYPDHYTRIKAEYEGPVRDESNTMFDQRSDLRHIETQASLNDHVYEN IPPKEVGFNSSSDLDVDSLNGYTSGDMHTDDDLSPDFIPNDVPVRCKTTVTFRKNTPKSH H
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Varicella-zoster virus (strain Oka vaccine) (HHV-3) (Human herpesvirus 3)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ORF12 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74,273 Da
NCBI Official Full Name
tegument protein VP11/12
NCBI Official Symbol
ORF12
NCBI Protein Information
modulates transactivating tegument protein VP16
UniProt Protein Name
Tegument protein UL46 homolog
UniProt Gene Name
ORF12
UniProt Entry Name
TEG1_VZVO

Uniprot Description

Plays a role in the activation of the host PI3K/AKT pathway to promote cell survival. Interacts with and activates PI3KR1 in order to phosphorylate host AKT on its activating residues. Activates the host AP-1 pathway by triggering phosphorylation of host ERK1/2. Participates in host BIM and BAD phosphorylation, leading to apoptosis inhibition.

Research Articles on ORF12

Similar Products

Product Notes

The ORF12 orf12 (Catalog #AAA7041289) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-661aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ORF12 orf12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MFSRFARSFS SDDRTRKSYD GSYQSFNAGE RDLPTPTRDW CSISQRITSE RVRDGCLIPT PGEALETAVK ALSEKTDSLT SPVLQSTERH SVLLGLHHNN VPESLVVSCM SNDVHDGFMQ RYMETIQRCL DDLKLSGDGL WWVYENTYWQ YLKYTTGAEV PVTSEKVNKK SKSTVLLFSS VVANKPISRH PFKSKVINSD YRGICQELRE ALGAVQKYMY FMRPDDPTNP SPDTRIRVQE IAAYTATGYG WMLWFLDVVD ARVCRHLKLQ FRRIRGPRAS VIPDDLLRRH LKTGPAVSAG TGVAFILAAT TASALTALLR ISVLWRKEEW RDGLNGTAAA IVAAVELITL LHHHFQYLIN MMLIGYACWG DGGLNDPYIL KALRAQGRFL YFAGQLVRTM STHSWVVLET STHMWFSRAV AQSILAHGGK PTKYYAQVLA ASKRYTPLHL RRISEPSSVS DQPYIRFNRL GSPIGTGIGN LECVCLTGNY LSDDVNASSH VINTEAPLNS IAPDTNRQRT SRVLVRPDTG LDVTVRKNHC LDIGHTDGSP VDPTYPDHYT RIKAEYEGPV RDESNTMFDQ RSDLRHIETQ ASLNDHVYEN IPPKEVGFNS SSDLDVDSLN GYTSGDMHTD DDLSPDFIPN DVPVRCKTTV TFRKNTPKSH H. It is sometimes possible for the material contained within the vial of "Alpha trans-inducing factor 74 kDa protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.