Gustatory and odorant receptor 7 (GPRor7) Recombinant Protein | GPRor7 recombinant protein
Recombinant Anopheles gambiae Gustatory and odorant receptor 7 (GPRor7)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gustatory and odorant receptor 7 (GPRor7); Recombinant Anopheles gambiae Gustatory and odorant receptor 7 (GPRor7); GPRor7 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-478aa; full length protein
Sequence
MQVQPTKYVGLVADLMPNIRLMQASGHFLFRYVTGPILIRKVYSWWTLAMVLIQFFAILG NLATNADDVNELTANTITTLFFTHSVTKFIYFAVNSENFYRTLAIWNQTNTHPLFAESDA RYHSIALAKMRKLLVLVMATTVLSVVAWVTITFFGESVKTVLDKATNETYTVDIPRLPIK SWYPWNAMSGPAYIFSFIYQIYFLLFSMVQSNLADVMFCSWLLLACEQLQHLKGIMRSLM ELSASLDTYRPNSSQLFRAISAGSKSELIINEEKDPDVKDFDLSGIYSSKADWGAQFRAP STLQTFDENGRNGNPNGLTRKQEMMVRSAIKYWVERHKHVVRLVSAIGDTYGPALLLHML TSTIKLTLLAYQATKIDGVNVYGLTVIGYLCYALAQVFLFCIFGNRLIEESSSVMEAAYS CHWYDGSEEAKTFVQIVCQQCQKAMTISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Anopheles gambiae (African malaria mosquito)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for GPRor7 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
54,020 Da
NCBI Official Full Name
AGAP002560-PA
NCBI Official Symbol
OR7_ANOGA
NCBI Protein Information
AGAP002560-PA
UniProt Protein Name
Odorant receptor coreceptor
UniProt Gene Name
Orco
UniProt Synonym Gene Names
GPRor7
UniProt Entry Name
ORCO_ANOGA
Uniprot Description
Odorant coreceptor which complexes with conventional odorant receptors (ORs) to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. Orco is a universal and integral part of the functional odorant receptor, involved in the dendritic localization of other olfactory receptors. Can form functional ion channels in the absence of an odor-binding OR. Plays a key role in preferred attraction of females for humans over non-human hosts for blood feeding. Human attraction plays a crucial role in the transmission of Plasmodium protozoans by the mosquito leading to infection diseases like malaria. Also required for the response to N,N-Diethyl-meta-toluamide (DEET), the most widely used insect repellent worldwide.
Similar Products
Product Notes
The GPRor7 orco (Catalog #AAA7016286) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-478aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the GPRor7 orco for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQVQPTKYVG LVADLMPNIR LMQASGHFLF RYVTGPILIR KVYSWWTLAM VLIQFFAILG NLATNADDVN ELTANTITTL FFTHSVTKFI YFAVNSENFY RTLAIWNQTN THPLFAESDA RYHSIALAKM RKLLVLVMAT TVLSVVAWVT ITFFGESVKT VLDKATNETY TVDIPRLPIK SWYPWNAMSG PAYIFSFIYQ IYFLLFSMVQ SNLADVMFCS WLLLACEQLQ HLKGIMRSLM ELSASLDTYR PNSSQLFRAI SAGSKSELII NEEKDPDVKD FDLSGIYSSK ADWGAQFRAP STLQTFDENG RNGNPNGLTR KQEMMVRSAI KYWVERHKHV VRLVSAIGDT YGPALLLHML TSTIKLTLLA YQATKIDGVN VYGLTVIGYL CYALAQVFLF CIFGNRLIEE SSSVMEAAYS CHWYDGSEEA KTFVQIVCQQ CQKAMTISGA KFFTVSLDLF ASVLGAVVTY FMVLVQLK. It is sometimes possible for the material contained within the vial of "Gustatory and odorant receptor 7 (GPRor7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
