Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Olfactory receptor 5I1 (OR5I1) Recombinant Protein | OR5I1 recombinant protein

Recombinant Human Olfactory receptor 5I1 (OR5I1)

Gene Names
OR5I1; OLF1; HSOlf1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Olfactory receptor 5I1 (OR5I1); Recombinant Human Olfactory receptor 5I1 (OR5I1); OR5I1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-314aa; full length protein
Sequence
MEFTDRNYTLVTEFILLGFPTRPELQIVLFLMFLTLYAIILIGNIGLMLLIRIDPHLQTP MYFFLSNLSFVDLCYFSDIVPKMLVNFLSENKSISYYGCALQFYFFCTFADTESFILAAM AYDRYVAICNPLLYTVVMSRGICMRLIVLSYLGGNMSSLVHTSFAFILKYCDKNVINHFF CDLPPLLKLSCTDTTINEWLLSTYGSSVEIICFIIIIISYFFILLSVLKIRSFSGRKKTF STCASHLTSVTIYQGTLLFIYSRPSYLYSPNTDKIISVFYTIFIPVLNPLIYSLRNKDVK DAAEKVLRSKVDSS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for OR5I1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,049 Da
NCBI Official Full Name
olfactory receptor 5I1
NCBI Official Synonym Full Names
olfactory receptor family 5 subfamily I member 1
NCBI Official Symbol
OR5I1
NCBI Official Synonym Symbols
OLF1; HSOlf1
NCBI Protein Information
olfactory receptor 5I1
UniProt Protein Name
Olfactory receptor 5I1
Protein Family
UniProt Gene Name
OR5I1
UniProt Synonym Gene Names
OLF1
UniProt Entry Name
OR5I1_HUMAN

NCBI Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]

Uniprot Description

OR5I1: Odorant receptor (Potential). Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 11q11

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; odorant binding; olfactory receptor activity

Biological Process: detection of chemical stimulus involved in sensory perception of smell; G-protein coupled receptor protein signaling pathway; signal transduction

Similar Products

Product Notes

The OR5I1 or5i1 (Catalog #AAA7025021) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-314aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the OR5I1 or5i1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEFTDRNYTL VTEFILLGFP TRPELQIVLF LMFLTLYAII LIGNIGLMLL IRIDPHLQTP MYFFLSNLSF VDLCYFSDIV PKMLVNFLSE NKSISYYGCA LQFYFFCTFA DTESFILAAM AYDRYVAICN PLLYTVVMSR GICMRLIVLS YLGGNMSSLV HTSFAFILKY CDKNVINHFF CDLPPLLKLS CTDTTINEWL LSTYGSSVEI ICFIIIIISY FFILLSVLKI RSFSGRKKTF STCASHLTSV TIYQGTLLFI YSRPSYLYSP NTDKIISVFY TIFIPVLNPL IYSLRNKDVK DAAEKVLRSK VDSS. It is sometimes possible for the material contained within the vial of "Olfactory receptor 5I1 (OR5I1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.