Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Putative olfactory receptor 52A4 (OR52A4) Recombinant Protein | OR52A4 recombinant protein

Recombinant Human Putative olfactory receptor 52A4 (OR52A4)

Gene Names
OR52A4P; OR52A4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative olfactory receptor 52A4 (OR52A4); Recombinant Human Putative olfactory receptor 52A4 (OR52A4); OR52A4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-304aa; Full length protein
Sequence
MALPITNGTLFMPFVLTFIGIPGFESVQCWIGIPFCATYVIALIGNSLLLIIIKSEPSLH EPMYIFLATLGATDISLSTSIVPKMLDIFWFHLPEIYFDACLFQMWLIHTFQGIESGVLL AMALDRCVAICYPLRRAIVFTRQLVTYIVVGVTLRPAILVIPCLLLIKCHLKLYRTKLIY HTYCERVALVKLATEDVYINKVYGILGAFIVGGLDFIFITLSYIQIFITVFHLPLKEARL KVFNTCIPHIYVFFQFYLLAFFFIFYSQIWILYPIICTYHLVQSLPTGPTIPQPLYLWVK DQTH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for OR52A4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
34,901 Da
NCBI Official Full Name
Olfactory receptor 52A4
NCBI Official Synonym Full Names
olfactory receptor family 52 subfamily A member 4 pseudogene
NCBI Official Symbol
OR52A4P
NCBI Official Synonym Symbols
OR52A4
UniProt Protein Name
Olfactory receptor 52A4
UniProt Gene Name
OR52A4P
UniProt Entry Name
O52A4_HUMAN

NCBI Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. Although originally considered to be a functional olfactory receptor, this family member is now considered to be pseudogene due to the presence of a C-terminal frameshift compared to other family members; this is also consistent with the Classifier for Olfactory Receptor Pseudogenes (CORP), as described in PMID:16939646. [provided by RefSeq, Jun 2011]

Uniprot Description

OR52A4: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. Although originally considered to be a functional olfactory receptor, this family member is now considered to be pseudogene due to the presence of a C-terminal frameshift compared to other family members; this is also consistent with the Classifier for Olfactory Receptor Pseudogenes (CORP), as described in PMID:16939646. [provided by RefSeq, Jun 2011]

Protein type: Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 11p15.4

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; olfactory receptor activity

Biological Process: detection of chemical stimulus involved in sensory perception of smell; G-protein coupled receptor protein signaling pathway; signal transduction

Similar Products

Product Notes

The OR52A4 or52a4p (Catalog #AAA7024952) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-304aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the OR52A4 or52a4p for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MALPITNGTL FMPFVLTFIG IPGFESVQCW IGIPFCATYV IALIGNSLLL IIIKSEPSLH EPMYIFLATL GATDISLSTS IVPKMLDIFW FHLPEIYFDA CLFQMWLIHT FQGIESGVLL AMALDRCVAI CYPLRRAIVF TRQLVTYIVV GVTLRPAILV IPCLLLIKCH LKLYRTKLIY HTYCERVALV KLATEDVYIN KVYGILGAFI VGGLDFIFIT LSYIQIFITV FHLPLKEARL KVFNTCIPHI YVFFQFYLLA FFFIFYSQIW ILYPIICTYH LVQSLPTGPT IPQPLYLWVK DQTH. It is sometimes possible for the material contained within the vial of "Putative olfactory receptor 52A4 (OR52A4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.