Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Odorant receptor 47b (Or47b) Recombinant Protein | Or47b recombinant protein

Recombinant Drosophila melanogaster Odorant receptor 47b (Or47b)

Gene Names
Or47b; 47b; 47E.2; CG13206; DmelCG13206; DOR25; DOR47E.2; OR 47b; OR47b; Or47E.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Odorant receptor 47b (Or47b); Recombinant Drosophila melanogaster Odorant receptor 47b (Or47b); Recombinant Odorant receptor 47b (Or47b); Odorant receptor 47b; Or47b recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-412
Sequence
MNDSGYQSNLSLLRVFLDEFRSVLRQESPGLIPRLAFYYVRAFLSLLCQYPNKKLASLPLYRWINLFIMCNVMTIFWTMFVALPESKNVIEMGDDLVWISGMALVFTKIFYMHLRCDEIDELISDFEYYNRELRPHNIDEEVLGWQRLCYVIESGLYINCFCLVNFFSAAIFLQPLLGEGKLPFHSVYPFQWHRLDLHPYTFWFLYIWQSLTSQHNLMSILMVDMVGISTFLQTALNLKLLCIEIRKLGDMEVSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFETMAAAAVDPKMAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQESM
Sequence Length
412
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,913 Da
NCBI Official Full Name
odorant receptor 47b
NCBI Official Synonym Full Names
Odorant receptor 47b
NCBI Official Symbol
Or47b
NCBI Official Synonym Symbols
47b; 47E.2; CG13206; DmelCG13206; DOR25; DOR47E.2; OR 47b; OR47b; Or47E.2
NCBI Protein Information
CG13206 gene product from transcript CG13206-RA; CG13206-PA; Or47b-PA; odorant receptor 47b; olfactory receptor 47E.2
UniProt Protein Name
Odorant receptor 47b
Protein Family
UniProt Gene Name
Or47b
UniProt Synonym Gene Names
DOR47E.2; Or47E.2
UniProt Entry Name
OR47B_DROME

Uniprot Description

Function: Complexes with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. They are necessary and sufficient to promote functional reconstitution of odor-evoked signaling in sensory neurons that normally respond only to carbon dioxide

By similarity.

Subunit structure: Interacts with Orco. Complexes exist early in the endomembrane system in olfactory sensory neurons (OSNs), coupling these complexes to the conserved ciliary trafficking pathway

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity.

Tissue specificity: Expressed in the antenna. Ref.3

Miscellaneous: The atypical heteromeric and topological design of the odorant receptors appears to be an insect-specific solution for odor recognition, making the OR/Orco complex an attractive target for the development of highly selective insect repellents to disrupt olfactory-mediated host-seeking behaviors of insect disease vectors. Odor-evoked OR currents are independent of known G-protein-coupled second messenger pathways.

Sequence similarities: Belongs to the heteromeric odorant receptor channel (TC 1.A.69) family. [View classification]

Research Articles on Or47b

Similar Products

Product Notes

The Or47b or47b (Catalog #AAA1250899) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-412. The amino acid sequence is listed below: MNDSGYQSNL SLLRVFLDEF RSVLRQESPG LIPRLAFYYV RAFLSLLCQY PNKKLASLPL YRWINLFIMC NVMTIFWTMF VALPESKNVI EMGDDLVWIS GMALVFTKIF YMHLRCDEID ELISDFEYYN RELRPHNIDE EVLGWQRLCY VIESGLYINC FCLVNFFSAA IFLQPLLGEG KLPFHSVYPF QWHRLDLHPY TFWFLYIWQS LTSQHNLMSI LMVDMVGIST FLQTALNLKL LCIEIRKLGD MEVSDKRFHE EFCRVVRFHQ HIIKLVGKAN RAFNGAFNAQ LMASFSLISI STFETMAAAA VDPKMAAKFV LLMLVAFIQL SLWCVSGTLV YTQSVEVAQA AFDINDWHTK SPGIQRDISF VILRAQKPLM YVAEPFLPFT LGTYMLVLKN CYRLLALMQE SM. It is sometimes possible for the material contained within the vial of "Odorant receptor 47b (Or47b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.