Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Olfactory receptor 2H2 (OR2H2) Recombinant Protein | OR2H2 recombinant protein

Recombinant Human Olfactory receptor 2H2 (OR2H2)

Gene Names
OR2H2; FAT11; OLFR2; OR2H3; OLFR42B; hs6M1-12; dJ271M21.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Olfactory receptor 2H2 (OR2H2); Recombinant Human Olfactory receptor 2H2 (OR2H2); Recombinant Olfactory receptor 2H2 (OR2H2); Olfactory receptor 2H2; Hs6M1-12 Olfactory receptor 2H3 Olfactory receptor-like protein FAT11; OR2H2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-312
Sequence
MVNQSSTPGFLLLGFSEHPGLERTLFVVVLTSYLLTLVGNTLIILLSALDPKLHSPMYFFLSNLSFLDLCFTTSCVPQMLVNLWGPKKTISFLDCSVQIFIFLSLGTTECILLTVMAFDRYVAVCQPLHYATIIHPRLCWQLASVAWVIGLVESVVQTPSTLHLPFCPDRQVDDFVCEVPALIRLSCEDTSYNEIQVAVASVFILVVPLSLILVSYGAITWAVLRINSAKGRRKAFGTCSSHLTVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFRRLLGKEMGLTQS
Sequence Length
312
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,763 Da
NCBI Official Full Name
olfactory receptor 2H2
NCBI Official Synonym Full Names
olfactory receptor, family 2, subfamily H, member 2
NCBI Official Symbol
OR2H2
NCBI Official Synonym Symbols
FAT11; OLFR2; OR2H3; OLFR42B; hs6M1-12; dJ271M21.2
NCBI Protein Information
olfactory receptor 2H2; Olfactory receptor 2; olfactory receptor 2H3; olfactory receptor OR6-36; olfactory receptor-like protein FAT11; olfactory receptor, family 2, subfamily H, member 3
UniProt Protein Name
Olfactory receptor 2H2
Protein Family
UniProt Gene Name
OR2H2
UniProt Synonym Gene Names
FAT11; OLFR2; OR2H3
UniProt Entry Name
OR2H2_HUMAN

NCBI Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]

Uniprot Description

OR2H2: Odorant receptor (Potential). Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; GPCR, family 1; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; olfactory receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; detection of chemical stimulus involved in sensory perception of smell; defense response; mating

Research Articles on OR2H2

Similar Products

Product Notes

The OR2H2 or2h2 (Catalog #AAA1098875) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-312. The amino acid sequence is listed below: MVNQSSTPGF LLLGFSEHPG LERTLFVVVL TSYLLTLVGN TLIILLSALD PKLHSPMYFF LSNLSFLDLC FTTSCVPQML VNLWGPKKTI SFLDCSVQIF IFLSLGTTEC ILLTVMAFDR YVAVCQPLHY ATIIHPRLCW QLASVAWVIG LVESVVQTPS TLHLPFCPDR QVDDFVCEVP ALIRLSCEDT SYNEIQVAVA SVFILVVPLS LILVSYGAIT WAVLRINSAK GRRKAFGTCS SHLTVVTLFY SSVIAVYLQP KNPYAQERGK FFGLFYAVGT PSLNPLIYTL RNKEVTRAFR RLLGKEMGLT QS. It is sometimes possible for the material contained within the vial of "Olfactory receptor 2H2 (OR2H2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.