Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Opsin-3 (OPN3) Recombinant Protein | OPN3 recombinant protein

Recombinant Human Opsin-3 (OPN3)

Gene Names
OPN3; ECPN; PPP1R116
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Opsin-3 (OPN3); Recombinant Human Opsin-3 (OPN3); OPN3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-402. Full length.
Sequence
MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL
Sequence Length
402
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for OPN3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,730 Da
NCBI Official Full Name
opsin-3
NCBI Official Synonym Full Names
opsin 3
NCBI Official Symbol
OPN3
NCBI Official Synonym Symbols
ECPN; PPP1R116
NCBI Protein Information
opsin-3
UniProt Protein Name
Opsin-3
Protein Family
UniProt Gene Name
OPN3
UniProt Synonym Gene Names
ECPN
UniProt Entry Name
OPN3_HUMAN

NCBI Description

Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. In addition to the visual opsins, mammals possess several photoreceptive non-visual opsins that are expressed in extraocular tissues. This gene, opsin 3, is strongly expressed in brain and testis and weakly expressed in liver, placenta, heart, lung, skeletal muscle, kidney, and pancreas. The gene may also be expressed in the retina. The protein has the canonical features of a photoreceptive opsin protein. [provided by RefSeq, Jul 2008]

Uniprot Description

encephalopsin: May play a role in encephalic photoreception. Belongs to the G-protein coupled receptor 1 family. Opsin subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1

Chromosomal Location of Human Ortholog: 1q43

Cellular Component: integral to membrane; integral to plasma membrane

Molecular Function: G-protein coupled photoreceptor activity; G-protein coupled receptor activity; photoreceptor activity

Biological Process: detection of light stimulus; detection of visible light; G-protein coupled receptor protein signaling pathway; phototransduction; protein-chromophore linkage; regulation of circadian rhythm

Research Articles on OPN3

Similar Products

Product Notes

The OPN3 opn3 (Catalog #AAA7024564) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-402. Full length. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the OPN3 opn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MYSGNRSGGH GYWDGGGAAG AEGPAPAGTL SPAPLFSPGT YERLALLLGS IGLLGVGNNL LVLVLYYKFQ RLRTPTHLLL VNISLSDLLV SLFGVTFTFV SCLRNGWVWD TVGCVWDGFS GSLFGIVSIA TLTVLAYERY IRVVHARVIN FSWAWRAITY IWLYSLAWAG APLLGWNRYI LDVHGLGCTV DWKSKDANDS SFVLFLFLGC LVVPLGVIAH CYGHILYSIR MLRCVEDLQT IQVIKILKYE KKLAKMCFLM IFTFLVCWMP YIVICFLVVN GHGHLVTPTI SIVSYLFAKS NTVYNPVIYV FMIRKFRRSL LQLLCLRLLR CQRPAKDLPA AGSEMQIRPI VMSQKDGDRP KKKVTFNSSS IIFIITSDES LSVDDSDKTN GSKVDVIQVR PL . It is sometimes possible for the material contained within the vial of "Opsin-3 (OPN3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.