Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Short-wave-sensitive opsin 1 (OPN1SW) Recombinant Protein | OPN1SW recombinant protein

Recombinant Human Short-wave-sensitive opsin 1 (OPN1SW)

Gene Names
OPN1SW; BCP; BOP; CBT
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Short-wave-sensitive opsin 1 (OPN1SW); Recombinant Human Short-wave-sensitive opsin 1 (OPN1SW); OPN1SW recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-348. Full length.
Sequence
MRKMSEEEFYLFKNISSVGPWDGPQYHIAPVWAFYLQAAFMGTVFLIGFPLNAMVLVATLRYKKLRQPLNYILVNVSFGGFLLCIFSVFPVFVASCNGYFVFGRHVCALEGFLGTVAGLVTGWSLAFLAFERYIVICKPFGNFRFSSKHALTVVLATWTIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAEREVSRMVVVMVGSFCVCYVPYAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN
Sequence Length
348
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for OPN1SW recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
611
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,135 Da
NCBI Official Full Name
short-wave-sensitive opsin 1
NCBI Official Synonym Full Names
opsin 1 (cone pigments), short-wave-sensitive
NCBI Official Symbol
OPN1SW
NCBI Official Synonym Symbols
BCP; BOP; CBT
NCBI Protein Information
short-wave-sensitive opsin 1
UniProt Protein Name
Short-wave-sensitive opsin 1
UniProt Gene Name
OPN1SW
UniProt Synonym Gene Names
BCP; BOP
UniProt Entry Name
OPSB_HUMAN

NCBI Description

This gene belongs to the G-protein coupled receptor 1 family, opsin subfamily. It encodes the blue cone pigment gene which is one of three types of cone photoreceptors responsible for normal color vision. Defects in this gene are the cause of tritan color blindness (tritanopia). Affected individuals lack blue and yellow sensory mechanisms while retaining those for red and green. Defective blue vision is characteristic. [provided by RefSeq, Jul 2008]

Uniprot Description

OPN1SW: Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal. Defects in OPN1SW are the cause of tritan color blindness (CBT). Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q32.1

Cellular Component: integral to plasma membrane; photoreceptor outer segment

Molecular Function: G-protein coupled photoreceptor activity; receptor activity

Biological Process: detection of visible light; G-protein coupled receptor protein signaling pathway; phototransduction; protein-chromophore linkage; retinoid metabolic process; signal transduction; visual perception

Disease: Tritanopia

Research Articles on OPN1SW

Similar Products

Product Notes

The OPN1SW opn1sw (Catalog #AAA7024556) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-348. Full length. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the OPN1SW opn1sw for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRKMSEEEFY LFKNISSVGP WDGPQYHIAP VWAFYLQAAF MGTVFLIGFP LNAMVLVATL RYKKLRQPLN YILVNVSFGG FLLCIFSVFP VFVASCNGYF VFGRHVCALE GFLGTVAGLV TGWSLAFLAF ERYIVICKPF GNFRFSSKHA LTVVLATWTI GIGVSIPPFF GWSRFIPEGL QCSCGPDWYT VGTKYRSESY TWFLFIFCFI VPLSLICFSY TQLLRALKAV AAQQQESATT QKAEREVSRM VVVMVGSFCV CYVPYAAFAM YMVNNRNHGL DLRLVTIPSF FSKSACIYNP IIYCFMNKQF QACIMKMVCG KAMTDESDTC SSQKTEVSTV SSTQVGPN. It is sometimes possible for the material contained within the vial of "Short-wave-sensitive opsin 1 (OPN1SW), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.