SDS-PAGE
Outer membrane protein A (ompA) Recombinant Protein | ompA recombinant protein
Recombinant Rickettsia conorii Outer membrane protein A (ompA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Outer membrane protein A (ompA); Recombinant Rickettsia conorii Outer membrane protein A (ompA); Outer membrane protein A; 190 kDa antigen; Cell surface antigen; rOmp A; rOmpACleaved into the following 2 chains:; 1. 120 kDa surface-exposed protein; 120 kDa outer membrane protein OmpA; 32 kDa beta peptide; ompA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1734-2021aa; Partial
Sequence
DMDAKFGAWISPFVGNATQKMCNSISGYKSDTTGGTIGFDGFVSDDLVLGLAYTRADTDIKLKNNKTGDKNKVESNIYSLYGLYSVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQLMAGYTYMMSENINLTPLAGLRYSTIKDKSYKETGTTYQNLTVKGKNYNTFDGLLGAKVSSNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQSKTSFDVGVGVTAKHKMMEYGINYDTNIGSKYFAQQGSVKVRVNF
Sequence Length
2021
Species
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for ompA recombinant protein
Elicits protective immunity.
Product Categories/Family for ompA recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51.8 kDa
NCBI Official Full Name
hypothetical protein RC1273
NCBI Official Symbol
rompA
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Outer membrane protein A
Protein Family
UniProt Gene Name
ompA
UniProt Synonym Gene Names
rOmpA
UniProt Entry Name
OMPA_RICCN
Uniprot Description
Elicits protective immunity.
Similar Products
Product Notes
The ompA ompa (Catalog #AAA1474738) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1734-2021aa; Partial. The amino acid sequence is listed below: DMDAKFGAWI SPFVGNATQK MCNSISGYKS DTTGGTIGFD GFVSDDLVLG LAYTRADTDI KLKNNKTGDK NKVESNIYSL YGLYSVPYEN LFVEAIASYS DNKIRSKSRR VIATTLETVG YQTANGKYKS ESYTGQLMAG YTYMMSENIN LTPLAGLRYS TIKDKSYKET GTTYQNLTVK GKNYNTFDGL LGAKVSSNIN VNEIVLTPEL YAMVDYAFKN KVSAIDARLQ GMTAPLPTNS FKQSKTSFDV GVGVTAKHKM MEYGINYDTN IGSKYFAQQG SVKVRVNF. It is sometimes possible for the material contained within the vial of "Outer membrane protein A (ompA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
