Tyramine/octopamine receptor (Oct-TyrR) Recombinant Protein | Oct-TyrR recombinant protein
Recombinant Drosophila melanogaster Tyramine/octopamine receptor (Oct-TyrR)
Gene Names
Oct-TyrR; CG7485; DmelCG7485; Dmoct/tyr; DmTAR1; DmTyrR; DrmOTR; hono; l(3)neo30; OA-R; OAR_DROME; Ocr; OcR; OctoR1; OctyR99AB; OTR; TAR1; Tyr; TyR; TYR; Tyr-dro; TyrR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tyramine/octopamine receptor (Oct-TyrR); Recombinant Drosophila melanogaster Tyramine/octopamine receptor (Oct-TyrR); Oct-TyrR recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
27-601aa; full length protein
Sequence
VSTTKSGSGNAARGYTDSDDDAGMGTEAVANISGSLVEGLTTVTAALSTAQADKDSAGEC EGAVEELHASILGLQLAVPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNF FIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALD RYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISSPPLIGWNDWPDEFTSATPCELTSQ RGYVIYSSLGSFFIPLAIMTIVYIEIFVATRRRLRERARANKLNTIALKSTELEPMANSS PVAASNSGSKSRLLASWLCCGRDRAQFATPMIQNDQESISSETHQPQDSSKAGPHGNSDP QQQHVVVLVKKSRRAKTKDSIKHGKTRGGRKSQSSSTCEPHGEQQLLPAGGDGGSCQPGG GHSGGGKSDAEISTESGSDPKGCIQVCVTQADEQTSLKLTPPQSSTGVAAVSVTPLQKKT SGVNQFIEEKQKISLSKERRAARTLGIIMGVFVICWLPFFLMYVILPFCQTCCPTNKFKN FITWLGYINSGLNPVIYTIFNLDYRRAFKRLLGLN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Oct-TyrR recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
64,674 Da
NCBI Official Full Name
Octopamine-Tyramine receptor, isoform B
NCBI Official Synonym Full Names
Octopamine-Tyramine receptor
NCBI Official Symbol
Oct-TyrR
NCBI Official Synonym Symbols
CG7485; DmelCG7485; Dmoct/tyr; DmTAR1; DmTyrR; DrmOTR; hono; l(3)neo30; OA-R; OAR_DROME; Ocr; OcR; OctoR1; OctyR99AB; OTR; TAR1; Tyr; TyR; TYR; Tyr-dro; TyrR
NCBI Protein Information
CG7485 gene product from transcript CG7485-RA
UniProt Protein Name
Tyramine/octopamine receptor
Protein Family
UniProt Gene Name
Oct-TyrR
UniProt Synonym Gene Names
OcR; OctyR99AB; TYR; TyrR
UniProt Entry Name
OAR_DROME
Uniprot Description
Receptor for both octopamine and tyramine, invertebrate neurotransmitters, and neuromodulators. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The rank order of potency for agonists is tyramine > octopamine > dopamine > epinephrine > norepinephrine > serotonin > histamine. For antagonists, the rank order is yohimbine > chlorpromazine > phentolamine > mianserine > cyproheptadine > dihydroergotamine > clonidine > synephrine. Tyramine has a functional role in the olfactory system as a neurotransmitter or a neuromodulator.
Research Articles on Oct-TyrR
Similar Products
Product Notes
The Oct-TyrR oct-tyrr (Catalog #AAA7024334) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-601aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Oct-TyrR oct-tyrr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VSTTKSGSGN AARGYTDSDD DAGMGTEAVA NISGSLVEGL TTVTAALSTA QADKDSAGEC EGAVEELHAS ILGLQLAVPE WEALLTALVL SVIIVLTIIG NILVILSVFT YKPLRIVQNF FIVSLAVADL TVALLVLPFN VAYSILGRWE FGIHLCKLWL TCDVLCCTSS ILNLCAIALD RYWAITDPIN YAQKRTVGRV LLLISGVWLL SLLISSPPLI GWNDWPDEFT SATPCELTSQ RGYVIYSSLG SFFIPLAIMT IVYIEIFVAT RRRLRERARA NKLNTIALKS TELEPMANSS PVAASNSGSK SRLLASWLCC GRDRAQFATP MIQNDQESIS SETHQPQDSS KAGPHGNSDP QQQHVVVLVK KSRRAKTKDS IKHGKTRGGR KSQSSSTCEP HGEQQLLPAG GDGGSCQPGG GHSGGGKSDA EISTESGSDP KGCIQVCVTQ ADEQTSLKLT PPQSSTGVAA VSVTPLQKKT SGVNQFIEEK QKISLSKERR AARTLGIIMG VFVICWLPFF LMYVILPFCQ TCCPTNKFKN FITWLGYINS GLNPVIYTIF NLDYRRAFKR LLGLN. It is sometimes possible for the material contained within the vial of "Tyramine/octopamine receptor (Oct-TyrR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
