Nuclear pore complex protein Nup88 (Nup88) Recombinant Protein | Nup88 recombinant protein
Recombinant Mouse Nuclear pore complex protein Nup88 (Nup88)
Gene Names
Nup88; Nup84; Prei2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nuclear pore complex protein Nup88 (Nup88); Recombinant Mouse Nuclear pore complex protein Nup88 (Nup88); Nup88 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-753, Full length protein
Sequence
MAAAVGPLGDGELWQSWLPNHVVFLRLREGVRNQSPAEAEKPAASTSPSCPSLPPHLPTRNLVFGLGGELFLWDAEGSAFLVVRLRGPSGGGVEPPLSQYQRLLCINPPLFEIHQVLLSPTQHHVALIGSKGLMALELPQRWGKDSEFEGGKATVNCSTIPIAERFFTSSTSLTLKHAAWYPSEMLDPHIVLLTSDNVIRIYSLREPQTPTKVIVLSEAEEESLILNKGRAYTASLGETAVAFDFGPLVTVSKNIFEQKDRDVVAYPLYILYENGETFLTYVSLLHSPGNIGKLLGPLPMHPAAEDNYGYDACAILCLPCVPNILVIATESGMLYHCVVLEGEEEDDQTLEKSWDPRADFIPSLYVFECVELELALKLASGEDDPFASDFSCPIKLHRDPKCPSRYHCSHEAGVHSVGLTWIHKLHKFLGSDEEDKDSLQELTAEQKCFVEHILCTKPLPCRQPAPIRGFWIVPDILGPTMICITSTYECLIRPLLSTVHPASPPLLCTQEDAEVAESPLRILAETPDSFEKHIKRILQRSAANPAFLKNCSARSSEKDLAPPPEECLQLISRATQVFREQYILKQDLAKEEIQRRVKLLCDQKRKQLEDLNYCREERVSHLFRKSLREMAERLADKYEEAKEKQEDIMNRMKKVLHSFHAQLPVLSDSERDMKKELQLIPDQLRHLGNAIKQVTMKKDYQQRKMEKVLSPQKPTITLSAYQRKCIQSILKEEGEHIREMVKQINDIRNHVTF
Sequence Length
753
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Nup88 recombinant protein
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins, a family of 50 to 100 proteins, are the main components of the nuclear pore complex in eukaryotic cells. This protein belongs to the nucleoporin family and is associated with the oncogenic nucleoporin CAN
Nup214 in a dynamic subcomplex. This protein is also overexpressed in a large number of malignant neoplasms and precancerous dysplasias.
Nup214 in a dynamic subcomplex. This protein is also overexpressed in a large number of malignant neoplasms and precancerous dysplasias.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
83,666 Da
NCBI Official Full Name
nuclear pore complex protein Nup88 isoform 2
NCBI Official Synonym Full Names
nucleoporin 88
NCBI Official Symbol
Nup88
NCBI Official Synonym Symbols
Nup84; Prei2
NCBI Protein Information
nuclear pore complex protein Nup88
UniProt Protein Name
Nuclear pore complex protein Nup88
UniProt Gene Name
Nup88
Uniprot Description
Essential component of nuclear pore complex.
Research Articles on Nup88
Similar Products
Product Notes
The Nup88 nup88 (Catalog #AAA1323760) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-753, Full length protein. The amino acid sequence is listed below: MAAAVGPLGD GELWQSWLPN HVVFLRLREG VRNQSPAEAE KPAASTSPSC PSLPPHLPTR NLVFGLGGEL FLWDAEGSAF LVVRLRGPSG GGVEPPLSQY QRLLCINPPL FEIHQVLLSP TQHHVALIGS KGLMALELPQ RWGKDSEFEG GKATVNCSTI PIAERFFTSS TSLTLKHAAW YPSEMLDPHI VLLTSDNVIR IYSLREPQTP TKVIVLSEAE EESLILNKGR AYTASLGETA VAFDFGPLVT VSKNIFEQKD RDVVAYPLYI LYENGETFLT YVSLLHSPGN IGKLLGPLPM HPAAEDNYGY DACAILCLPC VPNILVIATE SGMLYHCVVL EGEEEDDQTL EKSWDPRADF IPSLYVFECV ELELALKLAS GEDDPFASDF SCPIKLHRDP KCPSRYHCSH EAGVHSVGLT WIHKLHKFLG SDEEDKDSLQ ELTAEQKCFV EHILCTKPLP CRQPAPIRGF WIVPDILGPT MICITSTYEC LIRPLLSTVH PASPPLLCTQ EDAEVAESPL RILAETPDSF EKHIKRILQR SAANPAFLKN CSARSSEKDL APPPEECLQL ISRATQVFRE QYILKQDLAK EEIQRRVKLL CDQKRKQLED LNYCREERVS HLFRKSLREM AERLADKYEE AKEKQEDIMN RMKKVLHSFH AQLPVLSDSE RDMKKELQLI PDQLRHLGNA IKQVTMKKDY QQRKMEKVLS PQKPTITLSA YQRKCIQSIL KEEGEHIREM VKQINDIRNH VTF. It is sometimes possible for the material contained within the vial of "Nuclear pore complex protein Nup88 (Nup88), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
