Nudix hydrolase 23, chloroplastic (NUDT23) Recombinant Protein | NUDT23 recombinant protein
Recombinant Arabidopsis thaliana Nudix hydrolase 23, chloroplastic (NUDT23)
Gene Names
NUDX23; ARABIDOPSIS THALIANA NUDIX HYDROLASE HOMOLOG 23; ATNUDT23; ATNUDX23; nudix hydrolase homolog 23; T6D20.4; T6D20_4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nudix hydrolase 23; chloroplastic (NUDT23); Recombinant Arabidopsis thaliana Nudix hydrolase 23; NUDT23 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
76-280, Full length protein
Sequence
VQSAGDVRKIKFCQWCGGPTKHEIPDGEEKLRAICTHCGKIAYQNPKMVVGCLIEHEGKVLLCKRNIQPSHGLWTLPAGYLEVGESAAQGAMRETWEEAGATVEVISPFAQLDIPLIGQTYVIFLAKLKNLHFAPGPESLECRLFALDEIPFDSLAFSSIYVTLNLYLEDLKKGKLKFHYGTINKRPGSSPSDIRAFSLDYHLQP
Sequence Length
205
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,794 Da
NCBI Official Full Name
nudix hydrolase homolog 23
NCBI Official Symbol
NUDX23
NCBI Official Synonym Symbols
ARABIDOPSIS THALIANA NUDIX HYDROLASE HOMOLOG 23; ATNUDT23; ATNUDX23; nudix hydrolase homolog 23; T6D20.4; T6D20_4
NCBI Protein Information
nudix hydrolase homolog 23
UniProt Protein Name
Nudix hydrolase 23, chloroplastic
Protein Family
UniProt Gene Name
NUDT23
UniProt Synonym Gene Names
NUDX23; AtNUDT23
NCBI Description
Encodes a plastid-localized Nudix hydrolase that has FAD pyrophosphohydrolase activity. Negative feedback regulation of the metabolism of flavins through the hydrolysis of FAD by AtNUDX23 in plastids is involved in the flavin homeostasis in plant cells.
Uniprot Description
Mediates the hydrolysis of some nucleoside diphosphate derivatives. Can use FAD and ADP-ribose as substrates.
Research Articles on NUDT23
Similar Products
Product Notes
The NUDT23 nudt23 (Catalog #AAA1217987) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 76-280, Full length protein. The amino acid sequence is listed below: VQSAGDVRKI KFCQWCGGPT KHEIPDGEEK LRAICTHCGK IAYQNPKMVV GCLIEHEGKV LLCKRNIQPS HGLWTLPAGY LEVGESAAQG AMRETWEEAG ATVEVISPFA QLDIPLIGQT YVIFLAKLKN LHFAPGPESL ECRLFALDEI PFDSLAFSSI YVTLNLYLED LKKGKLKFHY GTINKRPGSS PSDIRAFSLD YHLQP. It is sometimes possible for the material contained within the vial of "Nudix hydrolase 23, chloroplastic (NUDT23), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
