Neurotensin/neuromedin N (NTS) Recombinant Protein | NTS recombinant protein
Recombinant Dog Neurotensin/neuromedin N (NTS)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neurotensin/neuromedin N (NTS); Recombinant Dog Neurotensin/neuromedin N (NTS); NTS recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-148, Full length protein
Sequence
SDSEEEMKALEADLLTNMHTSKISKASVSSWKMTLLNVCSFVNNLNSQAEETGEFREEELITRRKFPTALDGFSLEAMLTIYQLQKICHSRAFQQWELIQEDVLDAGNDKNEKEEVIKRKIPYIL
Sequence Length
125
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for NTS recombinant protein
This gene encodes a common precursor for two peptides, neuromedin N and neurotensin. Neurotensin is a secreted tridecapeptide, which is widely distributed throughout the central nervous system, and may function as a neurotransmitter or a neuromodulator. It may be involved in dopamine-associated pathophysiological events, in the maintenance of gut structure and function, and in the regulation of fat metabolism. Tissue-specific processing may lead to the formation in some tissues of larger forms of neuromedin N and neurotensin. The large forms may represent more stable peptides that are also biologically active.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19,863 Da
NCBI Official Full Name
neurotensin/neuromedin N
NCBI Official Synonym Full Names
neurotensin
NCBI Official Symbol
NTS
NCBI Protein Information
neurotensin/neuromedin N
UniProt Protein Name
Neurotensin/neuromedin N
Protein Family
UniProt Gene Name
NTS
UniProt Synonym Gene Names
NN; NmN; NT
Uniprot Description
Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
Similar Products
Product Notes
The NTS nts (Catalog #AAA966246) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-148, Full length protein. The amino acid sequence is listed below: SDSEEEMKAL EADLLTNMHT SKISKASVSS WKMTLLNVCS FVNNLNSQAE ETGEFREEEL ITRRKFPTAL DGFSLEAMLT IYQLQKICHS RAFQQWELIQ EDVLDAGNDK NEKEEVIKRK IPYIL. It is sometimes possible for the material contained within the vial of "Neurotensin/neuromedin N (NTS), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
