Netrin-4 (NTN4) Recombinant Protein | NTN4 recombinant protein
Recombinant Human Netrin-4 (NTN4), partial
Gene Names
NTN4; PRO3091
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Netrin-4 (NTN4); Recombinant Human Netrin-4 (NTN4); partial; Netrin-4(Beta-netrin)(Hepar-derived netrin-like protein); NTN4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
184-395aa, Partial
Sequence
KYSSPFPCTGGEVIFKALSPPYDTENPYSAKVQEQLKITNLRVQLLKRQSCPCQRNDLNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTAGSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCDDCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPC
Species
Homo sapiens (Human)
Relevance
May play an important role in neural, kidney and vascular development. Promotes neurite elongation from olfactory bulb explants.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for NTN4 recombinant protein
References
A novel member of the netrin family, beta-netrin, shares homology with the beta chain of laminin. Identification, expression, and functional characterization.Koch M., Murrell J.R., Hunter D.D., Olson P.F., Jin W., Keene D.R., Brunken W.J., Burgeson R.E.J. Cell Biol. 151:221-234(2000)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
67,529 Da
NCBI Official Full Name
netrin-4 isoform 1
NCBI Official Synonym Full Names
netrin 4
NCBI Official Symbol
NTN4
NCBI Official Synonym Symbols
PRO3091
NCBI Protein Information
netrin-4
UniProt Protein Name
Netrin-4
Protein Family
UniProt Gene Name
NTN4
NCBI Description
This gene encodes a member of the netrin family of proteins, which function in various biological processes including axon guidance, tumorogenesis, and angiogenesis. Netrins are laminin-related proteins that have an N-terminal laminin-type domain, epidermal growth factor-like repeat domain, and a positively charged heparin-binding domain at the C-terminus. The protein encoded by this gene is involved in processes including neurite growth and migration, angiogenesis and mural cell adhesion to endothelial cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]
Uniprot Description
May play an important role in neural, kidney and vascular development. Promotes neurite elongation from olfactory bulb explants.
Research Articles on NTN4
Similar Products
Product Notes
The NTN4 ntn4 (Catalog #AAA9018618) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 184-395aa, Partial. The amino acid sequence is listed below: KYSSPFPCTG GEVIFKALSP PYDTENPYSA KVQEQLKITN LRVQLLKRQS CPCQRNDLNE EPQHFTHYAI YDFIVKGSCF CNGHADQCIP VHGFRPVKAP GTFHMVHGKC MCKHNTAGSH CQHCAPLYND RPWEAADGKT GAPNECRTCK CNGHADTCHF DVNVWEASGN RSGGVCDDCQ HNTEGQYCQR CKPGFYRDLR RPFSAPDACK PC. It is sometimes possible for the material contained within the vial of "Netrin-4 (NTN4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
