Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Netrin-1 (Ntn1) Recombinant Protein | Ntn1 recombinant protein

Recombinant Rat Netrin-1 (Ntn1)

Gene Names
Ntn1; netrin-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Netrin-1 (Ntn1); Recombinant Rat Netrin-1 (Ntn1); Ntn1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-604, full length protein
Sequence
GPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSMEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIAXKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSXLVIQWRDTWARRXRKFQQREKKGKCKKA
Sequence Length
580
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ntn1 recombinant protein
Netrin is included in a family of laminin-related secreted proteins. The function of this gene has not yet been defined; however, netrin is thought to be involved in axon guidance and cell migration during development. Mutations and loss of expression of netrin suggest that variation in netrin may be involved in cancer development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
67,873 Da
NCBI Official Full Name
Netrin-1
NCBI Official Synonym Full Names
netrin 1
NCBI Official Symbol
Ntn1
NCBI Official Synonym Symbols
netrin-1
NCBI Protein Information
netrin-1
UniProt Protein Name
Netrin-1
Protein Family
UniProt Gene Name
Ntn1

NCBI Description

plays a role in axon guidance during development; may also be involved in cell-cell interactions in the adult nervous system [RGD, Feb 2006]

Uniprot Description

Netrins control guidance of CNS commissural axons and peripheral motor axons. Its association with either DCC or some UNC5 receptors will lead to axon attraction or repulsion, respectively. It also serve as a survival factor via its association with its receptors which prevent the initiation of apoptosis. Involved in colorectal tumorigenesis by regulating apoptosis ().

Research Articles on Ntn1

Similar Products

Product Notes

The Ntn1 ntn1 (Catalog #AAA1283540) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-604, full length protein. The amino acid sequence is listed below: GPGLSMFAGQ AAQPDPCSDE NGHPRRCIPD FVNAAFGKDV RVSSTCGRPP ARYCVVSERG EERLRSCHLC NSSDPKKAHP PAFLTDLNNP HNLTCWQSEN YLQFPHNVTL TLSLGKKFEV TYVSLQFCSP RPESMAIYKS MDYGRTWVPF QFYSTQCRKM YNRPHRAPIT KQNEQEAVCT DSHTDMRPLS GGLIAFSTLD GRPSAHDFDN SPVLQDWVTA TDIRVAFSRL HTFGDENEDD SELARDSYYY AVSDLQVGGR CKCNGHAARC VRDRDDSLVC DCRHNTAGPE CDRCKPFHYD RPWQRATARE ANECVACNCN LHARRCRFNM ELYKLSGRKS GGVCLNCRHN TAGRHCHYCK EGFYRDMGKP ITHRKACKAC DCHPVGAAGK TCNQTTGQCP CKDGVTGITC NRCAKGYQQS RSPIAPCIKI PVAPPTTAAS SMEEPEDCDS YCKASKGKLK MNMKKYCRKD YAVQIHILKA DKAGDWWKFT VNIISVYKQG TSRIRRGDQS LWIRSRDIAX KCPKIKPLKK YLLLGNAEDS PDQSGIVADK SXLVIQWRDT WARRXRKFQQ REKKGKCKKA. It is sometimes possible for the material contained within the vial of "Netrin-1 (Ntn1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.