Putative methyltransferase NSUN5 (NSUN5) Recombinant Protein | NSUN5 recombinant protein
Recombinant Human Putative methyltransferase NSUN5 (NSUN5)
Gene Names
NSUN5; NOL1; p120; NOL1R; NSUN5A; WBSCR20; WBSCR20A; p120(NOL1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative methyltransferase NSUN5 (NSUN5); Recombinant Human Putative methyltransferase NSUN5 (NSUN5); NSUN5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-429, Full length protein
Sequence
GLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPR
Sequence Length
428
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for NSUN5 recombinant protein
This gene encodes a member of the evolutionarily conserved NOL1
NOP2
Sun domain family. The encoded protein may function as a DNA methyltransferase in the nucleus. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
NOP2
Sun domain family. The encoded protein may function as a DNA methyltransferase in the nucleus. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,478 Da
NCBI Official Full Name
probable 28S rRNA (cytosine-C(5))-methyltransferase isoform 3
NCBI Official Synonym Full Names
NOP2/Sun RNA methyltransferase family member 5
NCBI Official Symbol
NSUN5
NCBI Official Synonym Symbols
NOL1; p120; NOL1R; NSUN5A; WBSCR20; WBSCR20A; p120(NOL1)
NCBI Protein Information
probable 28S rRNA (cytosine-C(5))-methyltransferase
UniProt Protein Name
Probable 28S rRNA (cytosine-C(5))-methyltransferase
UniProt Gene Name
NSUN5
UniProt Synonym Gene Names
NSUN5A; WBSCR20; WBSCR20A; NOL1R
NCBI Description
This gene encodes a member of an evolutionarily conserved family of proteins that may function as methyltransferases. This gene is located in a larger region of chromosome 7 that is deleted in Williams-Beuren syndrome, a multisystem developmental disorder. There are two pseudogenes for this gene located in the same region of chromosome 7. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
Uniprot Description
S-adenosyl-L-methionine-dependent methyltransferase that specifically methylates the C5 position of cytosine 3782 in 28S rRNA.
Research Articles on NSUN5
Similar Products
Product Notes
The NSUN5 nsun5 (Catalog #AAA1407843) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-429, Full length protein. The amino acid sequence is listed below: GLYAAAAGVL AGVESRQGSI KGLVYSSNFQ NVKQLYALVC ETQRYSAVLD AVIASAGLLR AEKKLRPHLA KVLVYELLLG KGFRGGGGRW KALLGRHQAR LKAELARLKV HRGVSRNEDL LEVGSRPGPA SQLPRFVRVN TLKTCSDDVV DYFKRQGFSY QGRASSLDDL RALKGKHFLL DPLMPELLVF PAQTDLHEHP LYRAGHLILQ DRASCLPAML LDPPPGSHVI DACAAPGNKT SHLAALLKNQ GKIFAFDLDA KRLASMATLL ARAGVSCCEL AEEDFLAVSP SDPRYHEVHY ILLDPSCSGS GMPSRQLEEP GAGTPSPVRL HALAGFQQRA LCHALTFPSL QRLVYSTCSL CQEENEDVVR DALQQNPGAF RLAPALPAWP HRGLSTFPGA EHCLRASPET TLSSGFFVAV IERVEVPR. It is sometimes possible for the material contained within the vial of "Putative methyltransferase NSUN5 (NSUN5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
