SDS-PAGE
Non-structural glycoprotein 4 Recombinant Protein | NSP4 recombinant protein
Recombinant Rotavirus A Non-structural glycoprotein 4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Non-structural glycoprotein 4; Recombinant Rotavirus A Non-structural glycoprotein 4; NSP4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
52-175aa; Cytoplasmic Domain
Sequence
PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEWESGKNPYEPREVTAAM
Sequence Length
175
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for NSP4 recombinant protein
Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the rough endoplasmic reticulum during viral maturation. Enterotoxin that causes a phospholipase C-dependent elevation of the intracellular calcium concentration in host intestinal mucosa cells. Increased concentration of intracellular calcium disrupts the cytoskeleton and the tight junctions, raising the paracellular permeability. Potentiates chloride ion secretion through a calcium ion-dependent signaling pathway, inducing age-dependent diarrhea. To perform this enterotoxigenic role in vivo, NSP4 is probably released from infected enterocytes in a soluble form capable of diffusing within the intestinal lumen and interacting with the plasma membrane receptors on neighboring epithelial cells. Possible receptors for NSP4 are alpha-1/beta-1 and alpha-2/beta-1 integrin heterodimers.
References
Genome heterogeneity of SA11 rotavirus due to reassortment with 'O' agent.Small C., Barro M., Brown T.L., Patton J.T.Virology 359:415-424(2007)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.7 kDa
NCBI Official Full Name
NSP4
NCBI Official Symbol
RVA_s10_gp1
NCBI Protein Information
assembly protein
UniProt Protein Name
Non-structural glycoprotein 4
Protein Family
UniProt Gene Name
NSP4
UniProt Synonym Gene Names
NSP4
UniProt Entry Name
NSP4_ROTSH
Uniprot Description
Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the rough endoplasmic reticulum during viral maturation ().
Research Articles on NSP4
Similar Products
Product Notes
The NSP4 nsp4 (Catalog #AAA1091339) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 52-175aa; Cytoplasmic Domain. The amino acid sequence is listed below: PTMKIALKTS KCSYKVVKYC IVTIFNTLLK LAGYKEQITT KDEIEKQMDR VVKEMRRQLE MIDKLTTREI EQVELLKRIY DKLTVQTTGE IDMTKEINQK NVRTLEEWES GKNPYEPREV TAAM. It is sometimes possible for the material contained within the vial of "Non-structural glycoprotein 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
