Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Non-structural maintenance of chromosomes element 3 homolog (NSMCE3) Recombinant Protein | NSMCE3 recombinant protein

Recombinant Human Non-structural maintenance of chromosomes element 3 homolog (NSMCE3)

Gene Names
NSMCE3; HCA4; LICS; NSE3; NDNL2; MAGEG1; MAGEL3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Non-structural maintenance of chromosomes element 3 homolog (NSMCE3); Recombinant Human Non-structural maintenance of chromosomes element 3 homolog (NSMCE3); NSMCE3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-304, Full length protein
Sequence
MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVSELVQFLLIKDQKKIPIKRADILKHVIGDYKDIFPDLFKRAAERLQYVFGYKLVELEPKSNTYILINTLEPVEEDAEMRGDQGTPTTGLLMIVLGLIFMKGNTIKETEAWDFLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPAQYCEALADEENRARPQPSGPAPSS
Sequence Length
304
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for NSMCE3 recombinant protein
This intronless gene encodes a member of the MAGE superfamily. The encoded protein is 76% identical to the mouse mage-g1 protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,308 Da
NCBI Official Full Name
non-structural maintenance of chromosomes element 3 homolog
NCBI Official Synonym Full Names
NSE3 homolog, SMC5-SMC6 complex component
NCBI Official Symbol
NSMCE3
NCBI Official Synonym Symbols
HCA4; LICS; NSE3; NDNL2; MAGEG1; MAGEL3
NCBI Protein Information
non-structural maintenance of chromosomes element 3 homolog
UniProt Protein Name
Non-structural maintenance of chromosomes element 3 homolog
UniProt Gene Name
NSMCE3
UniProt Synonym Gene Names
Non-SMC element 3 homolog

NCBI Description

The protein encoded by this gene is part of the SMC5-6 chromatin reorganizing complex and is a member of the MAGE superfamily. This is an intronless gene. [provided by RefSeq, May 2011]

Uniprot Description

Component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination (PubMed:20864041, PubMed:27427983). The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). In vitro enhances ubiquitin ligase activity of NSMCE1. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex (PubMed:20864041). May be a growth suppressor that facilitates the entry of the cell into cell cycle arrest ().

Research Articles on NSMCE3

Similar Products

Product Notes

The NSMCE3 nsmce3 (Catalog #AAA1371473) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-304, Full length protein. The amino acid sequence is listed below: MLQKPRNRGR SGGQAERDRD WSHSGNPGAS RAGEDARVLR DGFAEEAPST SRGPGGSQGS QGPSPQGARR AQAAPAVGPR SQKQLELKVS ELVQFLLIKD QKKIPIKRAD ILKHVIGDYK DIFPDLFKRA AERLQYVFGY KLVELEPKSN TYILINTLEP VEEDAEMRGD QGTPTTGLLM IVLGLIFMKG NTIKETEAWD FLRRLGVYPT KKHLIFGDPK KLITEDFVRQ RYLEYRRIPH TDPVDYEFQW GPRTNLETSK MKVLKFVAKV HNQDPKDWPA QYCEALADEE NRARPQPSGP APSS. It is sometimes possible for the material contained within the vial of "Non-structural maintenance of chromosomes element 3 homolog (NSMCE3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.