Genome polyprotein Recombinant Protein | flavivirus polyprotein gene recombinant protein
Recombinant Zika virus Genome polyprotein, partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Genome polyprotein; Recombinant Zika virus Genome polyprotein; partial; flavivirus polyprotein gene recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1415-1463aa+GGGGSGGGG+1499-1668aa, Partial
Sequence
KSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMRGGGGSGGGGSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERARNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKR
Species
Zika virus (ZIKV)
Relevance
Serine protease subunit NS2B:Required cofactor for the serine protease function of NS3.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for flavivirus polyprotein gene recombinant protein
References
"Crystal structure of unlinked NS2B-NS3 protease from Zika virus."Zhang Z., Li Y., Loh Y.R., Phoo W.W., Hung A.W., Kang C., Luo D.Science 354:1597-1600(2016)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
polyprotein
NCBI Official Symbol
flavivirus polyprotein gene
NCBI Protein Information
flavivirus polyprotein; capsid protein C; membrane glycoprotein precursor M; envelope protein E; nonstructural protein NS1; nonstructural protein NS2A; nonstructural protein NS2B; nonstructural protein NS3; nonstructural protein NS4A; nonstructural protei
UniProt Protein Name
Genome polyprotein
Protein Family
UniProt Gene Name
NS4B
UniProt Synonym Gene Names
NS4B
Uniprot Description
Protein C: Plays a role in virus budding by binding to membrane and gathering the viral RNA into a nucleoc$apsid that forms the core of a mature virus particle. During virus entry, may induce genome penetration in host cytoplasm after hemifusion induced by surface proteins. Can migrate tot cell nucleus where it modulates host functions.
Research Articles on flavivirus polyprotein gene
Similar Products
Product Notes
The flavivirus polyprotein gene ns4b (Catalog #AAA9018576) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1415-1463aa+GGGGSGGGG+1499-1668aa, Partial. The amino acid sequence is listed below: KSVDMYIERA GDITWEKDAE VTGNSPRLDV ALDESGDFSL VEEDGPPMRG GGGSGGGGSG ALWDVPAPKE VKKGETTDGV YRVMTRRLLG STQVGVGVMQ EGVFHTMWHV TKGAALRSGE GRLDPYWGDV KQDLVSYCGP WKLDAAWDGL SEVQLLAVPP GERARNIQTL PGIFKTKDGD IGAVALDYPA GTSGSPILDK CGRVIGLYGN GVVIKNGSYV SAITQGKR. It is sometimes possible for the material contained within the vial of "Genome polyprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
