Neurensin-1 (Nrsn1) Recombinant Protein | Nrsn1 recombinant protein
Recombinant Mouse Neurensin-1 (Nrsn1)
Gene Names
Nrsn1; Vmp; Neuro-p24; Neurensin-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neurensin-1 (Nrsn1); Recombinant Mouse Neurensin-1 (Nrsn1); Recombinant Neurensin-1 (Nrsn1); Neurensin-1; Neuro-p24 Vesicular membrane protein of 24 kDa; Vesicular membrane protein p24; Nrsn1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-196
Sequence
MTSCSNTCGSRRAQADTEGGYQQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSVFWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEADFMVVDTHAVKYNGALDTCKLAGAVLFCIGGTSMAGCLLMSVFAKSYSKEEKFLQQKFKERIADIKAHTQPITKAPGPGDTKIPVTLSRVQNVQPLSAT
Sequence Length
196
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,595 Da
NCBI Official Full Name
neurensin-1
NCBI Official Synonym Full Names
neurensin 1
NCBI Official Symbol
Nrsn1
NCBI Official Synonym Symbols
Vmp; Neuro-p24; Neurensin-1
NCBI Protein Information
neurensin-1; vesicular membrane protein p24; vesicular membrane protein of 24 kDa
UniProt Protein Name
Neurensin-1
Protein Family
UniProt Gene Name
Nrsn1
UniProt Synonym Gene Names
Vmp; Vesicular membrane protein p24
UniProt Entry Name
NRSN1_MOUSE
Uniprot Description
NRSN1: May play an important role in neural organelle transport, and in transduction of nerve signals or in nerve growth. May play a role in neurite extension. Belongs to the VMP family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Cellular Component: neuron projection; transport vesicle; growth cone; cell soma; membrane; cytoplasmic membrane-bound vesicle; integral to membrane
Biological Process: nervous system development
Research Articles on Nrsn1
Similar Products
Product Notes
The Nrsn1 nrsn1 (Catalog #AAA965978) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-196. The amino acid sequence is listed below: MTSCSNTCGS RRAQADTEGG YQQRYGVRSY LHQFYEDCTA SIWEYEDDFQ IQRSPNRWSS VFWKVGLISG TVFVILGLTV LAVGFLVPPK IEAFGEADFM VVDTHAVKYN GALDTCKLAG AVLFCIGGTS MAGCLLMSVF AKSYSKEEKF LQQKFKERIA DIKAHTQPIT KAPGPGDTKI PVTLSRVQNV QPLSAT. It is sometimes possible for the material contained within the vial of "Neurensin-1 (Nrsn1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
