Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Nuclear receptor subfamily 4 group A member 1 (Nr4a1) Recombinant Protein | Nr4a1 recombinant protein

Recombinant Mouse Nuclear receptor subfamily 4 group A member 1 (Nr4a1)

Gene Names
Nr4a1; Hmr; N10; TR3; Gfrp; Hbr1; NP10; TIS1; GFRP1; Hbr-1; NGFIB; nur77; NGFI-B; NUR77-1; NUR77-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nuclear receptor subfamily 4 group A member 1 (Nr4a1); Recombinant Mouse Nuclear receptor subfamily 4 group A member 1 (Nr4a1); Nr4a1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-601, Full length protein
Sequence
MPCIQAQYGTPATSPGPRDHLTGDPLALEFGKPTMDLASPETAPAAPATLPSFSTFMDGYTGEFDTFLYQLPGTTQPCSSACSSASSTSSSSSSATSPASASFKFEDFQVYGCYPGTLSGPLDETLSSSGSEYYGSPCSAPSPSTPNFQPSQLSPWDGSFGHFSPSQTYEGLWAWTEQLPKASSGPPPPPTFFSFSPPTGPSPSLAQSSLKLFPPPATHQLGEGESYSMPAAFPGLAPTSPNRDTSGILDAPVTSTKSRSGASGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPTNLLTSLIRAHLDSGPSTAKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSGSLDVIRKWAEKIPGFIELCPGDQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHQLQCARGFGDWIDNILAFSRSLHSLGVDVPAFACLSALVLITDRHGLQDPRRVEELQNRIASCLKEHMATVAGDPQPASCLSRLLGKLPELRTLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLSF
Sequence Length
601
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Nr4a1 recombinant protein
This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,738 Da
NCBI Official Full Name
nuclear receptor subfamily 4 group A member 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 4, group A, member 1
NCBI Official Symbol
Nr4a1
NCBI Official Synonym Symbols
Hmr; N10; TR3; Gfrp; Hbr1; NP10; TIS1; GFRP1; Hbr-1; NGFIB; nur77; NGFI-B; NUR77-1; NUR77-2
NCBI Protein Information
nuclear receptor subfamily 4 group A member 1
UniProt Protein Name
Nuclear receptor subfamily 4 group A member 1
UniProt Gene Name
Nr4a1
UniProt Synonym Gene Names
Gfrp; Hmr; N10; Nur77

Uniprot Description

Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3'. May inhibit NF-kappa-B transactivation of IL2. Participates in energy homeostasis by sequestrating the kinase STK11 in the nucleus, thereby attenuating cytoplasmic AMPK activation ().

Research Articles on Nr4a1

Similar Products

Product Notes

The Nr4a1 nr4a1 (Catalog #AAA965303) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-601, Full length protein. The amino acid sequence is listed below: MPCIQAQYGT PATSPGPRDH LTGDPLALEF GKPTMDLASP ETAPAAPATL PSFSTFMDGY TGEFDTFLYQ LPGTTQPCSS ACSSASSTSS SSSSATSPAS ASFKFEDFQV YGCYPGTLSG PLDETLSSSG SEYYGSPCSA PSPSTPNFQP SQLSPWDGSF GHFSPSQTYE GLWAWTEQLP KASSGPPPPP TFFSFSPPTG PSPSLAQSSL KLFPPPATHQ LGEGESYSMP AAFPGLAPTS PNRDTSGILD APVTSTKSRS GASGGSEGRC AVCGDNASCQ HYGVRTCEGC KGFFKRTVQK SAKYICLANK DCPVDKRRRN RCQFCRFQKC LAVGMVKEVV RTDSLKGRRG RLPSKPKQPP DASPTNLLTS LIRAHLDSGP STAKLDYSKF QELVLPRFGK EDAGDVQQFY DLLSGSLDVI RKWAEKIPGF IELCPGDQDL LLESAFLELF ILRLAYRSKP GEGKLIFCSG LVLHQLQCAR GFGDWIDNIL AFSRSLHSLG VDVPAFACLS ALVLITDRHG LQDPRRVEEL QNRIASCLKE HMATVAGDPQ PASCLSRLLG KLPELRTLCT QGLQRIFCLK LEDLVPPPPI VDKIFMDTLS F. It is sometimes possible for the material contained within the vial of "Nuclear receptor subfamily 4 group A member 1 (Nr4a1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.