Glucocorticoid Receptor (NR3C1) Recombinant Protein | NR3C1 recombinant protein

Recombinant Human Glucocorticoid Receptor (NR3C1), Partial

Cat. Num. AAA7115237

• Gene Names: NR3C1; GR; GCR; GRL; GCCR; GCRST
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Glucocorticoid Receptor (NR3C1); Recombinant Human Glucocorticoid Receptor (NR3C1); Partial; Nuclear receptor subfamily 3 group C member 1; GRL; NR3C1 recombinant protein

• Host: E Coli
• Specificity: Widely expressed including bone, stomach, lung, liver, colon, breast, ovary, pancreas and kidney (PubMed:25847991). In the heart, detected in left and right atria, left and right ventricles, aorta, apex, intraventricular septum, and atrioventricular node as well as whole adult and fetal heart (PubMed:10902803). Isoform Beta: Widely expressed including brain, bone marrow, thymus, spleen, liver, kidney, pancreas, lung, fat, skeletal muscle, heart, placenta and blood leukocytes (PubMed:7769088, PubMed:8621628). Isoform Alpha-2: Expressed at low level.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 521-777aa; Partial
• Sequence: VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
• Sequence Length: 777

• Species: Human
• Tag: N-terminal 6xHis-Trx-tagged
• Subcellular Location: Isoform Alpha: Cytoplasm, Nucleus, Mitochondrion, Cytoplasm, cytoskeleton, spindle, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Note=After ligand activation, translocates from the cytoplasm to the nucleus, SUBCELLULAR LOCATION: Isoform Beta: Nucleus, Cytoplasm, Note=Expressed predominantly in the nucleus with some expression also detected in the cytoplasm, SUBCELLULAR LOCATION: Isoform Alpha-B: Nucleus, Cytoplasm
• Protein Families: Nuclear hormone receptor family, NR3 subfamily
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

Related Product Information for NR3C1 recombinant protein

Receptor for glucocorticoids (GC). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Involved in chromatin remodeling. Plays a role in rapid mRNA degradation by binding to the 5' UTR of target mRNAs and interacting with PNRC2 in a ligand-dependent manner which recruits the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay. Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth.

Product Categories/Family for NR3C1 recombinant protein

Epigenetics and Nuclear Signaling

References

"A new transcript splice variant of the human glucocorticoid receptor: identification and tissue distribution of hGR Delta 313-338, an alternative exon 2 transactivation domain isoform." Turner J.D., Schote A.B., Keipes M., Muller C.P. Ann. N. Y. Acad. Sci. 1095:334-341(2007).

NCBI and Uniprot Product Information

• NCBI GI #: 4504133
• NCBI GeneID: 2908
• NCBI Accession #: NP_000167.1
• NCBI GenBank Nucleotide #: NM_000176.3
• UniProt Accession #: P04150
• Molecular Weight: 47.8 kDa
• NCBI Official Full Name: glucocorticoid receptor isoform alpha
• NCBI Official Synonym Full Names: nuclear receptor subfamily 3 group C member 1
• NCBI Official Symbol: NR3C1
• NCBI Official Synonym Symbols: GR; GCR; GRL; GCCR; GCRST
• NCBI Protein Information: glucocorticoid receptor
• UniProt Protein Name: Glucocorticoid receptor
• Protein Family: Glucocorticoid receptor
• UniProt Gene Name: NR3C1
• UniProt Synonym Gene Names: GRL; GR
• UniProt Entry Name: GCR_HUMAN

NCBI Description

This gene encodes glucocorticoid receptor, which can function both as a transcription factor that binds to glucocorticoid response elements in the promoters of glucocorticoid responsive genes to activate their transcription, and as a regulator of other transcription factors. This receptor is typically found in the cytoplasm, but upon ligand binding, is transported into the nucleus. It is involved in inflammatory responses, cellular proliferation, and differentiation in target tissues. Mutations in this gene are associated with generalized glucocorticoid resistance. Alternative splicing of this gene results in transcript variants encoding either the same or different isoforms. Additional isoforms resulting from the use of alternate in-frame translation initiation sites have also been described, and shown to be functional, displaying diverse cytoplasm-to-nucleus trafficking patterns and distinct transcriptional activities (PMID:15866175). [provided by RefSeq, Feb 2011]

Uniprot Description

GR: transcription factor of the nuclear receptor family. Receptor for glucocorticoids (GC). Binds to glucocorticoid response elements (GRE) and modulates other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Three alternatively spliced isoforms have been described.

Protein type: Transcription factor; DNA-binding; Mitochondrial; Nuclear receptor

Chromosomal Location of Human Ortholog: 5q31.3

Cellular Component: nucleoplasm; membrane; mitochondrial matrix; cytoplasm; cytosol; nucleus

Molecular Function: protein dimerization activity; glucocorticoid receptor activity; protein binding; zinc ion binding; transcription factor activity; steroid binding

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; transcription, DNA-dependent; maternal behavior; adrenal gland development; regulation of glucocorticoid biosynthetic process; chromatin modification; signal transduction; glucocorticoid metabolic process; glucocorticoid mediated signaling; regulation of transcription, DNA-dependent; positive regulation of neuron apoptosis; glucocorticoid receptor signaling pathway; gene expression; positive regulation of transcription from RNA polymerase II promoter; regulation of gluconeogenesis

Disease: Glucocorticoid Resistance, Generalized