Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Na (+)-translocating NADH-quinone reductase subunit D Recombinant Protein | nqrD recombinant protein

Recombinant Yersinia pseudotuberculosis serotype O:1b Na (+)-translocating NADH-quinone reductase subunit D

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Na (+)-translocating NADH-quinone reductase subunit D; Recombinant Yersinia pseudotuberculosis serotype O:1b Na (+)-translocating NADH-quinone reductase subunit D; Recombinant Na (+)-translocating NADH-quinone reductase subunit D; Na(+)-translocating NADH-quinone reductase subunit D; Na(+)-NQR subunit D; Na(+)-translocating NQR subunit D EC= 1.6.5.-; NQR complex subunit D NQR-1 subunit D; nqrD recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-209
Sequence
MADSKEIKRVLLSPLFDNNPIALQILGVCSALAVTTKLETALVMTLAVTLVTAFSSFFISLIRNHIPNSVRIIVQMVIIASLVIVVDQVLRAYAYEISKQLSVFVGLIITNCIVMGRAEAYAMKSPPIESFMDGIGNGLGYGVILVLVGFVRELVGSGKLFGVTVLETVQNGGWYLPNGLFLLAPSAFFIIGLLIWGLRTLKPAQIEKE
Sequence Length
209
Species
Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,643 Da
NCBI Official Full Name
Na(+)-translocating NADH-quinone reductase subunit D
NCBI Official Symbol
nqrD
NCBI Protein Information
Na(+)-translocating NADH-quinone reductase subunit D
UniProt Protein Name
Na(+)-translocating NADH-quinone reductase subunit D
UniProt Gene Name
nqrD
UniProt Synonym Gene Names
Na(+)-NQR subunit D
UniProt Entry Name
NQRD_YERP3

Uniprot Description

Function: NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol by two successive reactions, coupled with the transport of Na+ ions from the cytoplasm to the periplasm. NqrA to NqrE are probably involved in the second step, the conversion of ubisemiquinone to ubiquinol

By similarity. HAMAP-Rule MF_00428

Catalytic activity: NADH + ubiquinone + Na+(In) = NAD+ + ubiquinol + Na+(Out). HAMAP-Rule MF_00428

Subunit structure: Composed of six subunits; NqrA, NqrB, NqrC, NqrD, NqrE and NqrF

By similarity.

Subcellular location: Cell inner membrane; Multi-pass membrane protein

Potential HAMAP-Rule MF_00428.

Sequence similarities: Belongs to the NqrDE/RnfAE family.

Similar Products

Product Notes

The nqrD nqrd (Catalog #AAA1232195) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-209. The amino acid sequence is listed below: MADSKEIKRV LLSPLFDNNP IALQILGVCS ALAVTTKLET ALVMTLAVTL VTAFSSFFIS LIRNHIPNSV RIIVQMVIIA SLVIVVDQVL RAYAYEISKQ LSVFVGLIIT NCIVMGRAEA YAMKSPPIES FMDGIGNGLG YGVILVLVGF VRELVGSGKL FGVTVLETVQ NGGWYLPNGL FLLAPSAFFI IGLLIWGLRT LKPAQIEKE. It is sometimes possible for the material contained within the vial of "Na (+)-translocating NADH-quinone reductase subunit D, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.