Nucleolar protein 3 Recombinant Protein | NOL3 recombinant protein

Recombinant Human Nucleolar protein 3

Cat. Num. AAA1199260

• Gene Names: NOL3; ARC; FCM; MYP; NOP; NOP30
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Nucleolar protein 3; Recombinant Human Nucleolar protein 3; Apoptosis repressor with CARD1; NOL3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-208aa; Full Length of Isoform 2
• Sequence: MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
• Sequence Length: 219

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for NOL3 recombinant protein

Isoform 1: May be involved in RNA splicing.

Product Categories/Family for NOL3 recombinant protein

Apoptosis

References

ARC, an inhibitor of apoptosis expressed in skeletal muscle and heart that interacts selectively with caspases.Koseki T., Inohara N., Chen S., Nunez G.Proc. Natl. Acad. Sci. U.S.A. 95:5156-5160(1998) Alternative splicing determines the intracellular localization of the novel nuclear protein Nop30 and its interaction with the splicing factor SRp30c.Stoss O., Schwaiger F.-W., Cooper T.A., Stamm S.J. Biol. Chem. 274:10951-10962(1999) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The sequence and analysis of duplication-rich human chromosome 16.Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J., Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.Nature 432:988-994(2004) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. Apoptosis repressor with caspase recruitment domain protects against cell death by interfering with Bax activation.Gustafsson A.B., Tsai J.G., Logue S.E., Crow M.T., Gottlieb R.A.J. Biol. Chem. 279:21233-21238(2004) Calcium binding of ARC mediates regulation of caspase 8 and cell death.Jo D.G., Jun J.I., Chang J.W., Hong Y.M., Song S., Cho D.H., Shim S.M., Lee H.J., Cho C., Kim D.H., Jung Y.K.Mol. Cell. Biol. 24:9763-9770(2004) Apoptosis repressor with caspase recruitment domain is required for cardioprotection in response to biomechanical and ischemic stress.Donath S., Li P., Willenbockel C., Al-Saadi N., Gross V., Willnow T., Bader M., Martin U., Bauersachs J., Wollert K.C., Dietz R., von Harsdorf R.Circulation 113:1203-1212(2006) The apoptosis inhibitor ARC undergoes ubiquitin-proteasomal-mediated degradation in response to death stimuli identification of a degradation-resistant mutant.Nam Y.J., Mani K., Wu L., Peng C.F., Calvert J.W., Foo R.S., Krishnamurthy B., Miao W., Ashton A.W., Lefer D.J., Kitsis R.N.J. Biol. Chem. 282:5522-5528(2007) Familial cortical myoclonus with a mutation in NOL3.Russell J.F., Steckley J.L., Coppola G., Hahn A.F., Howard M.A., Kornberg Z., Huang A., Mirsattari S.M., Merriman B., Klein E., Choi M., Lee H.Y., Kirk A., Nelson-Williams C., Gibson G., Baraban S.C., Lifton R.P., Geschwind D.H., Fu Y.H., Ptacek L.J.Ann. Neurol. 72:175-183(2012) Screening of mutations in NOL3 in a myoclonic syndromes series.Macerollo A., Mencacci N.E., Erro R., Cordivari C., Edwards M.J., Wood N.W., Bhatia K.P.J. Neurol. 261:1830-1831(2014)

NCBI and Uniprot Product Information

• NCBI GI #: 297632352
• NCBI GeneID: 8996
• NCBI Accession #: NP_001171986.1
• NCBI GenBank Nucleotide #: NM_001185057.2
• UniProt Accession #: O60936; O60937; B4DFL0
• Molecular Weight: 38.6 kDa
• NCBI Official Full Name: nucleolar protein 3 isoform Nop30
• NCBI Official Synonym Full Names: nucleolar protein 3
• NCBI Official Symbol: NOL3
• NCBI Official Synonym Symbols: ARC; FCM; MYP; NOP; NOP30
• NCBI Protein Information: nucleolar protein 3
• UniProt Protein Name: Nucleolar protein 3
• Protein Family: Nucleolar protein
• UniProt Gene Name: NOL3
• UniProt Synonym Gene Names: Nop30
• UniProt Entry Name: NOL3_HUMAN

NCBI Description

This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

Isoform 1: May be involved in RNA splicing.