Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Nocturnin (Ccrn4l) Recombinant Protein | Ccrn4l recombinant protein

Recombinant Rat Nocturnin (Ccrn4l)

Gene Names
Noct; Ccr4; Ccrn4l; Ccrn4lb
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nocturnin (Ccrn4l); Recombinant Rat Nocturnin (Ccrn4l); Ccrn4l recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-253, full length protein
Sequence
ALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRYQRDFVDLRTDCSSSHPPIRVMQWNILAQALGEGKDNFVQCPVEALKWEERKCLILEEILAYQPDILCLQEVDHYFDTLQPLLSRLGYQGTFFPKPWSPCLDVEHNNGPDGCALFFLQSRFKLINSTNIRLTAMTLKTNQVAIAQTLECKESGRQFCIAVTHLKARTGWERFRSAQGCDLLQSLQNITEGAKIPLIVCGDFNAEP
Sequence Length
253
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ccrn4l recombinant protein
This protein is highly similar to Nocturnin, a gene identified as a circadian clock regulated gene in Xenopus laevis. This protein and Nocturnin protein share similarity with the C-terminal domain of a yeast transcription factor, carbon catabolite repression 4 (CCR4). The mRNA abundance of a similar gene in mouse has been shown to exhibit circadian rhythmicity, which suggests a role for this protein in clock function or as a circadian clock effector.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,122 Da
NCBI Official Full Name
nocturnin
NCBI Official Synonym Full Names
nocturnin
NCBI Official Symbol
Noct
NCBI Official Synonym Symbols
Ccr4; Ccrn4l; Ccrn4lb
NCBI Protein Information
nocturnin
UniProt Protein Name
Nocturnin
UniProt Gene Name
Noct

NCBI Description

mouse homolog may be involved in circadian rhythm [RGD, Feb 2006]

Uniprot Description

Circadian deadenylase which plays an important role in post-transcriptional regulation of metabolic genes under circadian control. Degrades poly(A) tails of specific target mRNAs leading to their degradation and suppression of translation. Exerts a rhythmic post-transcriptional control of genes necessary for metabolic functions including nutrient absorption, glucose/insulin sensitivity, lipid metabolism, adipogenesis, inflammation and osteogenesis. Plays an important role in favoring adipogenesis over osteoblastogenesis and acts as a key regulator of the adipogenesis/osteogenesis balance. Promotes adipogenesis by activating PPARG transcriptional activity in a deadenylase-independent manner by facilitating its nuclear translocation. Regulates circadian expression of NOS2 in the liver and negatively regulates the circadian expression of IGF1 in the bone. Critical for proper development of early embryos ().

Similar Products

Product Notes

The Ccrn4l noct (Catalog #AAA1429587) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-253, full length protein. The amino acid sequence is listed below: ALAKTLNSSA ASQHPEYLVS PDPEHLEPID PKELLEECRA VLHTRPPRYQ RDFVDLRTDC SSSHPPIRVM QWNILAQALG EGKDNFVQCP VEALKWEERK CLILEEILAY QPDILCLQEV DHYFDTLQPL LSRLGYQGTF FPKPWSPCLD VEHNNGPDGC ALFFLQSRFK LINSTNIRLT AMTLKTNQVA IAQTLECKES GRQFCIAVTH LKARTGWERF RSAQGCDLLQ SLQNITEGAK IPLIVCGDFN AEP. It is sometimes possible for the material contained within the vial of "Nocturnin (Ccrn4l), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.