Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Neuromedin-B receptor (Nmbr) Recombinant Protein | Nmbr recombinant protein

Recombinant Rat Neuromedin-B receptor (Nmbr)

Gene Names
Nmbr; NMB-R
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neuromedin-B receptor (Nmbr); Recombinant Rat Neuromedin-B receptor (Nmbr); Recombinant Neuromedin-B receptor (Nmbr); Neuromedin-B receptor; NMB-R; Neuromedin-B-preferring bombesin receptor; Nmbr recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-390
Sequence
MPPRSLPNLSLPTEASESELEPEVWENDFLPDSDGTTAELVIRCVIPSLYLIIISVGLLGNIMLVKIFLTNSTMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWVFGKLGCKLIPAIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGVVLWTSLKAVGIWVVSVLLAVPEAVFSEVARIGSSDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLVIISIYYYHIAKTLIRSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFVFCWFPNHILYLYRSFNYKEIDPSLGHMIVTLVARVLSFSNSCVNPFALYLLSESFRKHFNSQLCCGQKSYPERSTSYLLSSSAVRMTSLKSNAKNVVTNSVLLNGHSTKQEIAL
Sequence Length
390
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,535 Da
NCBI Official Full Name
neuromedin-B receptor
NCBI Official Synonym Full Names
neuromedin B receptor
NCBI Official Symbol
Nmbr
NCBI Official Synonym Symbols
NMB-R
NCBI Protein Information
neuromedin-B receptor; neuromedin-B-preferring bombesin receptor
UniProt Protein Name
Neuromedin-B receptor
Protein Family
UniProt Gene Name
Nmbr
UniProt Synonym Gene Names
NMB-R
UniProt Entry Name
NMBR_RAT

NCBI Description

bombesin receptor that binds neuromedin-B [RGD, Feb 2006]

Uniprot Description

NMBR: Receptor for neuromedin-B. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR

Cellular Component: cytoplasm; integral to membrane; plasma membrane

Molecular Function: neuropeptide receptor activity; bombesin receptor activity

Biological Process: neuropeptide signaling pathway; bombesin receptor signaling pathway

Similar Products

Product Notes

The Nmbr nmbr (Catalog #AAA968441) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-390. The amino acid sequence is listed below: MPPRSLPNLS LPTEASESEL EPEVWENDFL PDSDGTTAEL VIRCVIPSLY LIIISVGLLG NIMLVKIFLT NSTMRSVPNI FISNLAAGDL LLLLTCVPVD ASRYFFDEWV FGKLGCKLIP AIQLTSVGVS VFTLTALSAD RYRAIVNPMD MQTSGVVLWT SLKAVGIWVV SVLLAVPEAV FSEVARIGSS DNSSFTACIP YPQTDELHPK IHSVLIFLVY FLIPLVIISI YYYHIAKTLI RSAHNLPGEY NEHTKKQMET RKRLAKIVLV FVGCFVFCWF PNHILYLYRS FNYKEIDPSL GHMIVTLVAR VLSFSNSCVN PFALYLLSES FRKHFNSQLC CGQKSYPERS TSYLLSSSAV RMTSLKSNAK NVVTNSVLLN GHSTKQEIAL. It is sometimes possible for the material contained within the vial of "Neuromedin-B receptor (Nmbr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.