Neuromedin-B receptor (NMBR) Recombinant Protein | NMBR recombinant protein
Recombinant Human Neuromedin-B receptor (NMBR)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neuromedin-B receptor (NMBR); Recombinant Human Neuromedin-B receptor (NMBR); Recombinant Neuromedin-B receptor (NMBR); Neuromedin-B receptor; NMB-R; Neuromedin-B-preferring bombesin receptor; NMBR recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-390
Sequence
MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLGNIMLVKIFITNSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIPVIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAVFSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLIKSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSLGHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAVRMTSLKSNAKNMVTNSVLLNGHSMKQEMAL
Sequence Length
390
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,435 Da
NCBI Official Full Name
neuromedin-B receptor
NCBI Official Synonym Full Names
neuromedin B receptor
NCBI Official Symbol
NMBR
NCBI Protein Information
neuromedin-B receptor; NMB-R; epididymis tissue protein Li 185a; neuromedin-B-preferring bombesin receptor
UniProt Protein Name
Neuromedin-B receptor
Protein Family
UniProt Gene Name
NMBR
UniProt Synonym Gene Names
NMB-R
UniProt Entry Name
NMBR_HUMAN
NCBI Description
Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue. [provided by RefSeq, Jul 2008]
Uniprot Description
NMBR: Receptor for neuromedin-B. Belongs to the G-protein coupled receptor 1 family.
Protein type: Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral; GPCR, family 1
Chromosomal Location of Human Ortholog: 6q24.1
Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane
Molecular Function: bombesin receptor activity
Biological Process: G-protein coupled receptor protein signaling pathway; bombesin receptor signaling pathway; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating)
Research Articles on NMBR
1. Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
Similar Products
Product Notes
The NMBR nmbr (Catalog #AAA964051) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-390. The amino acid sequence is listed below: MPSKSLSNLS VTTGANESGS VPEGWERDFL PASDGTTTEL VIRCVIPSLY LLIITVGLLG NIMLVKIFIT NSAMRSVPNI FISNLAAGDL LLLLTCVPVD ASRYFFDEWM FGKVGCKLIP VIQLTSVGVS VFTLTALSAD RYRAIVNPMD MQTSGALLRT CVKAMGIWVV SVLLAVPEAV FSEVARISSL DNSSFTACIP YPQTDELHPK IHSVLIFLVY FLIPLAIISI YYYHIAKTLI KSAHNLPGEY NEHTKKQMET RKRLAKIVLV FVGCFIFCWF PNHILYMYRS FNYNEIDPSL GHMIVTLVAR VLSFGNSCVN PFALYLLSES FRRHFNSQLC CGRKSYQERG TSYLLSSSAV RMTSLKSNAK NMVTNSVLLN GHSMKQEMAL. It is sometimes possible for the material contained within the vial of "Neuromedin-B receptor (NMBR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
