Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

NK-tumor recognition Recombinant Protein | NKTR recombinant protein

Recombinant Human NK-tumor recognition protein

Gene Names
NKTR; p104
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NK-tumor recognition; Recombinant Human NK-tumor recognition protein; Natural-killer cells cyclophilin-related proteinIncluding the following 1 domains:Putative peptidyl-prolyl cis-trans isomerase (EC:5.2.1.8); PPIaseAlternative name(s):Rotamase; NKTR recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
10-175aa; Partial
Sequence
HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV
Sequence Length
1462
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for NKTR recombinant protein
Component of a putative tumor-recognition complex. Involved in the function of NK cells.
Product Categories/Family for NKTR recombinant protein
References
A cyclophilin-related protein involved in the function of natural killer cells.Anderson S.K., Gallinger S., Roder J., Frey J., Young H.A., Ortaldo J.R.Proc. Natl. Acad. Sci. U.S.A. 90:542-546(1993) Anderson S.K.Structure of the human NKTR gene.Anderson S.K.Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.Cell 127:635-648(2006) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.Sci. Signal. 2:RA46-RA46(2009) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.4 kDa
NCBI Official Full Name
NK-tumor recognition protein
NCBI Official Synonym Full Names
natural killer cell triggering receptor
NCBI Official Symbol
NKTR
NCBI Official Synonym Symbols
p104
NCBI Protein Information
NK-tumor recognition protein
UniProt Protein Name
NK-tumor recognition protein
UniProt Gene Name
NKTR
UniProt Synonym Gene Names
NK-TR protein; PPIase
UniProt Entry Name
NKTR_HUMAN

NCBI Description

This gene encodes a membrane-anchored protein with a hydrophobic amino terminal domain and a cyclophilin-like PPIase domain. It is present on the surface of natural killer cells and facilitates their binding to targets. Its expression is regulated by IL2 activation of the cells. [provided by RefSeq, Jul 2008]

Uniprot Description

NKTR: Component of a putative tumor-recognition complex. Involved in the function of NK cells.

Protein type: EC 5.2.1.8; Cell surface

Chromosomal Location of Human Ortholog: 3p22.1

Cellular Component: membrane

Molecular Function: cyclosporin A binding; peptidyl-prolyl cis-trans isomerase activity

Biological Process: protein folding; protein peptidyl-prolyl isomerization

Similar Products

Product Notes

The NKTR nktr (Catalog #AAA962880) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 10-175aa; Partial. The amino acid sequence is listed below: HFDIEINREP VGRIMFQLFS DICPKTCKNF LCLCSGEKGL GKTTGKKLCY KGSTFHRVVK NFMIQGGDFS EGNGKGGESI YGGYFKDENF ILKHDRAFLL SMANRGKHTN GSQFFITTKP APHLDGVHVV FGLVISGFEV IEQIENLKTD AASRPYADVR VIDCGV. It is sometimes possible for the material contained within the vial of "NK-tumor recognition, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.