Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Nickel transport system permease protein nikC (nikC) Recombinant Protein | nikC recombinant protein

Recombinant Escherichia coli Nickel transport system permease protein nikC (nikC)

Gene Names
nikC; ECK3462; hydC; hydD; JW3443
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nickel transport system permease protein nikC (nikC); Recombinant Escherichia coli Nickel transport system permease protein nikC (nikC); Recombinant Nickel transport system permease protein nikC (nikC); Nickel transport system permease protein nikC; nikC recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-277
Sequence
MNFFLSSRWSVRLALIIIALLALIALTSQWWLPYDPQAIDLPSRLLSPDAQHWLGTDHLGRDIFSRLMAATRVSLGSVMACLLLVLTLGLVIGGSAGLIGGRVDQATMRVADMFMTFPTSILSFFMVGVLGTGLTNVIIAIALSHWAWYARMVRSLVISLRQREFVLASRLSGAGHVRVFVDHLAGAVIPSLLVLATLDIGHMMLHVAGMSFLGLGVTAPTAEWGVMINDARQYIWTQPLQMFWPGLALFISVMAFNLVGDALRDHLDPHLVTEHAH
Sequence Length
277
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,362 Da
NCBI Official Full Name
nickel transporter subunit
NCBI Official Symbol
nikC
NCBI Official Synonym Symbols
ECK3462; hydC; hydD; JW3443
NCBI Protein Information
nickel transporter subunit
UniProt Protein Name
Nickel transport system permease protein NikC
UniProt Gene Name
nikC
UniProt Entry Name
NIKC_ECOLI

NCBI Description

Mutants display nickel-remediated formate hydrogen-lyase, hydrogenase, and hydrogenase-related fumarase defects. [More information is available at EcoGene: EG12077]. The NikABCDE ATP-dependent nickel (II) uptake system is a member of the ATP-Binding Cassette (ABC) Superfamily of transporters . [More information is available at EcoCyc: EG12077].

Uniprot Description

Function: Involved in a nickel transport system, probably translocates nickel through the bacterial inner membrane.

Subunit structure: Probably forms a heterodimeric pore with NikB.

Subcellular location: Cell inner membrane; Multi-pass membrane protein.

Sequence similarities: Belongs to the binding-protein-dependent transport system permease family. OppBC subfamily.Contains 1 ABC transmembrane type-1 domain.

Similar Products

Product Notes

The nikC nikc (Catalog #AAA1246931) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-277. The amino acid sequence is listed below: MNFFLSSRWS VRLALIIIAL LALIALTSQW WLPYDPQAID LPSRLLSPDA QHWLGTDHLG RDIFSRLMAA TRVSLGSVMA CLLLVLTLGL VIGGSAGLIG GRVDQATMRV ADMFMTFPTS ILSFFMVGVL GTGLTNVIIA IALSHWAWYA RMVRSLVISL RQREFVLASR LSGAGHVRVF VDHLAGAVIP SLLVLATLDI GHMMLHVAGM SFLGLGVTAP TAEWGVMIND ARQYIWTQPL QMFWPGLALF ISVMAFNLVG DALRDHLDPH LVTEHAH. It is sometimes possible for the material contained within the vial of "Nickel transport system permease protein nikC (nikC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.