Nickel transport system permease protein nikB (nikB) Recombinant Protein | nikB recombinant protein
Recombinant Escherichia coli Nickel transport system permease protein nikB (nikB)
Gene Names
nikB; ECK3461; hydC; hydD; JW3442
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nickel transport system permease protein nikB (nikB); Recombinant Escherichia coli Nickel transport system permease protein nikB (nikB); nikB recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-314aa; full length protein
Sequence
MLRYVLRRFLLLIPMVLAASVIIFLMLRLGTGDPALDYLRLSNLPPTPEMLASTRTMLGL DQPLYVQYGTWLWKALHLDFGISFASQRPVLDDMLNFLPATLELAGAALVLILLTSVPLG IWAARHRDRLPDFAVRFIAFLGVSMPNFWLAFLLVMAFSVYLQWLPAMGYGGWQHIILPA VSIAFMSLAINARLLRASMLDVAGQRHVTWARLRGLNDKQTERRHILRNASLPMITAVGM HIGELIGGTMIIENIFAWPGVGRYAVSAIFNRDYPVIQCFTLMMVVVFVVCNLIVDLLNA ALDPRIRRHEGAHA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for nikB recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35,248 Da
NCBI Official Full Name
nickel ABC transporter permease
NCBI Official Symbol
nikB
NCBI Official Synonym Symbols
ECK3461; hydC; hydD; JW3442
NCBI Protein Information
nickel ABC transporter permease
UniProt Protein Name
Nickel transport system permease protein NikB
Protein Family
UniProt Gene Name
nikB
UniProt Entry Name
NIKB_ECOLI
NCBI Description
Mutants display nickel-remediated formate hydrogen-lyase, hydrogenase, and hydrogenase-related fumarase defects. [More information is available at EcoGene: EG12076]. The NikABCDE ATP-dependent nickel (II) uptake system is a member of the ATP-Binding Cassette (ABC) Superfamily of transporters . [More information is available at EcoCyc: EG12076].
Uniprot Description
Involved in a nickel transport system, probably translocates nickel through the bacterial inner membrane.
Similar Products
Product Notes
The nikB nikb (Catalog #AAA7023306) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-314aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the nikB nikb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLRYVLRRFL LLIPMVLAAS VIIFLMLRLG TGDPALDYLR LSNLPPTPEM LASTRTMLGL DQPLYVQYGT WLWKALHLDF GISFASQRPV LDDMLNFLPA TLELAGAALV LILLTSVPLG IWAARHRDRL PDFAVRFIAF LGVSMPNFWL AFLLVMAFSV YLQWLPAMGY GGWQHIILPA VSIAFMSLAI NARLLRASML DVAGQRHVTW ARLRGLNDKQ TERRHILRNA SLPMITAVGM HIGELIGGTM IIENIFAWPG VGRYAVSAIF NRDYPVIQCF TLMMVVVFVV CNLIVDLLNA ALDPRIRRHE GAHA. It is sometimes possible for the material contained within the vial of "Nickel transport system permease protein nikB (nikB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
