Transforming Growth Factor-Beta 2 Active Protein | TGF Beta2 active protein
Transforming Growth Factor-Beta 2, Recombinant Protein
Gene Names
TGFB2; TGF-beta-2
Purity
Greater than 97.0% as determined by SDS-PAGE.
Synonyms
Transforming Growth Factor-Beta 2; Recombinant Protein; TGF Beta2 active protein
Host
Nicotiana benthamiana
Purity/Purification
Greater than 97.0% as determined by SDS-PAGE.
Form/Format
Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4.
Sequence
HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH EPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASAS PCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS
Biological Activity
The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 < 40ng/ml, corresponding to a specific activity of 25,000 units/mg.
Reconstitution
It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M?-cm H2O not less than 1ug/40ul, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Related Product Information for TGF Beta2 active protein
TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.
Product Categories/Family for TGF Beta2 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
TGF beta2, partial
NCBI Official Synonym Full Names
transforming growth factor, beta 2
NCBI Official Symbol
TGFB2
NCBI Official Synonym Symbols
TGF-beta-2
NCBI Protein Information
transforming growth factor beta-2
UniProt Protein Name
Transforming growth factor beta-2
UniProt Gene Name
TGFB2
UniProt Synonym Gene Names
TGF-beta-2; LAP
UniProt Entry Name
TGFB2_CHICK
Uniprot Description
TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.
Similar Products
Product Notes
The TGF Beta2 tgfb2 (Catalog #AAA555435) is an Active Protein produced from Nicotiana benthamiana and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: HHHHHHALDA AYCFRNVQDN CCLRPLYIDF KRDLGWKWIH EPKGYNANFC AGACPYLWSS DTQHSRVLSL YNTINPEASA S PCCVSQDLEP LTI LYYIGKTPKI EQLSNMIVKS CKCS. It is sometimes possible for the material contained within the vial of "Transforming Growth Factor-Beta 2, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
