Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Morphogenetic protein-7 Active Protein | BMP 7 active protein

Recombinant Human Bone Morphogenetic protein-7, Plant

Gene Names
BMP7; OP-1
Synonyms
Morphogenetic protein-7; Recombinant Human Bone Morphogenetic protein-7; Plant; BMP 7 Human; Bone Morphogenetic Protein-7 Human Recombinant; Osteogenic Protein 1; BMP-7; BMP 7 Plant; BMP 7 active protein
Ordering
For Research Use Only!
Host
Nicotiana benthamiana
Form/Format
BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH
Sequence Length
431
Solubility
Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/ ul.
Biological Activity
The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.
Related Product Information for BMP 7 active protein
Introduction: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
Product Categories/Family for BMP 7 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
655
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,313 Da
NCBI Official Full Name
bone morphogenetic protein 7
NCBI Official Synonym Full Names
bone morphogenetic protein 7
NCBI Official Symbol
BMP7
NCBI Official Synonym Symbols
OP-1
NCBI Protein Information
bone morphogenetic protein 7; osteogenic protein 1
UniProt Protein Name
Bone morphogenetic protein 7
UniProt Gene Name
BMP7
UniProt Synonym Gene Names
OP1; BMP-7; OP-1
UniProt Entry Name
BMP7_HUMAN

NCBI Description

The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development and possible bone inductive activity. [provided by RefSeq, Jul 2008]

Uniprot Description

BMP7: Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis. Homodimer; disulfide-linked. Interacts with SOSTDC1. Interacts with TWSG1. Expressed in the kidney and bladder. Lower levels seen in the brain. Belongs to the TGF-beta family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20q13

Cellular Component: extracellular matrix; extracellular space; extracellular region

Molecular Function: heparin binding; protein binding; growth factor activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: response to peptide hormone stimulus; axon guidance; negative regulation of MAP kinase activity; extracellular matrix organization and biogenesis; positive regulation of apoptosis; positive regulation of transcription, DNA-dependent; negative regulation of NF-kappaB import into nucleus; embryonic pattern specification; response to estradiol stimulus; negative regulation of cell cycle; regulation of apoptosis; BMP signaling pathway; response to vitamin D; epithelial cell differentiation; ureteric bud development; dendrite development; mesonephros development; skeletal development; embryonic limb morphogenesis; ossification; positive regulation of heterotypic cell-cell adhesion; positive regulation of bone mineralization; odontogenesis of dentine-containing teeth; positive regulation of osteoblast differentiation; negative regulation of neuron differentiation; mesenchymal cell differentiation; branching morphogenesis of a tube; mesoderm formation; inhibition of NF-kappaB transcription factor; cartilage development; negative regulation of mitosis; negative regulation of phosphorylation; epithelial to mesenchymal transition; negative regulation of Notch signaling pathway; steroid hormone mediated signaling; positive regulation of transcription from RNA polymerase II promoter; embryonic camera-type eye morphogenesis; negative regulation of transcription, DNA-dependent; metanephros development; neurite morphogenesis; growth

Research Articles on BMP 7

Similar Products

Product Notes

The BMP 7 bmp7 (Catalog #AAA144662) is an Active Protein produced from Nicotiana benthamiana and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: HHHHHHSTGS KQRSQNRSKT PKNQEALRMA NVAENSSSDQ RQACKKHELY VSFRDLGWQD WIIAPEGYAA YYCEGECAFP LNSYMNATNH AIVQTLVHFI NPETVPKPCC APTQLNAISV LYFDDSSVIL KKYRNMVVRA CGCH. It is sometimes possible for the material contained within the vial of "Morphogenetic protein-7, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.