Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase NHLRC1 (Nhlrc1) Recombinant Protein | Nhlrc1 recombinant protein

Recombinant Rat E3 ubiquitin-protein ligase NHLRC1 (Nhlrc1)

Gene Names
Nhlrc1; Epm2b
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase NHLRC1 (Nhlrc1); Recombinant Rat E3 ubiquitin-protein ligase NHLRC1 (Nhlrc1); Nhlrc1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-396, full length protein
Sequence
MGEEAAGVRPELVREAEVSLLECKVCFERFGHRQQRRPRNLPCGHVVCLACVAALAHPRTLALECPFCRRACRACDTSDCLPVLHLLELLGSTLHASPAALSAASCAPGALTCYHAFGGWGTLVNPTGLALCPKTGRVVVVHDGKRRVKIFDSGGGGAHQFGEKGDAAHDVKYPLDVAVTNDCHVVVTDAGDCSLKVFDFFGQIKLVVGKQFSLPWGVEITPHNGVLVTDAEAGTLHLLEADFPEGVLRRIERLQAHLCNPRGVAVSWLTGAIAVLEHPCALGTSSGNNTRVKVFNSSMQLIGQVDSFGLNLLFPSKITASAVTFDHQGNVIVADTSGPAIVCLGKPEEFPALKPMVTHGLSRPVALVFTKENSLLVLDSASHSIKVFKVMEGNGG
Sequence Length
396
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,089 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase NHLRC1
NCBI Official Synonym Full Names
NHL repeat containing E3 ubiquitin protein ligase 1
NCBI Official Symbol
Nhlrc1
NCBI Official Synonym Symbols
Epm2b
NCBI Protein Information
E3 ubiquitin-protein ligase NHLRC1
UniProt Protein Name
E3 ubiquitin-protein ligase NHLRC1
UniProt Gene Name
Nhlrc1
UniProt Synonym Gene Names
Epm2b

NCBI Description

human homolog is a putative E3 ubiquitin ligase associated with Lafora progressive myoclonus epilepsy and possibly involved in clearance of polyglucosans from dendrites [RGD, Feb 2006]

Uniprot Description

E3 ubiquitin-protein ligase. Together with the phosphatase EPM2A/laforin, appears to be involved in the clearance of toxic polyglucosan and protein aggregates via multiple pathways. In complex with EPM2A/laforin and HSP70, suppresses the cellular toxicity of misfolded proteins by promoting their degradation through the ubiquitin-proteasome system (UPS). Ubiquitinates the glycogen-targeting protein phosphatase subunits PPP1R3C/PTG and PPP1R3D in a laforin-dependent manner and targets them for proteasome-dependent degradation, thus decreasing glycogen accumulation. Polyubiquitinates EPM2A/laforin and ubiquitinates AGL and targets them for proteasome-dependent degradation. Also promotes proteasome-independent protein degradation through the macroautophagy pathway.

Similar Products

Product Notes

The Nhlrc1 nhlrc1 (Catalog #AAA1286331) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-396, full length protein. The amino acid sequence is listed below: MGEEAAGVRP ELVREAEVSL LECKVCFERF GHRQQRRPRN LPCGHVVCLA CVAALAHPRT LALECPFCRR ACRACDTSDC LPVLHLLELL GSTLHASPAA LSAASCAPGA LTCYHAFGGW GTLVNPTGLA LCPKTGRVVV VHDGKRRVKI FDSGGGGAHQ FGEKGDAAHD VKYPLDVAVT NDCHVVVTDA GDCSLKVFDF FGQIKLVVGK QFSLPWGVEI TPHNGVLVTD AEAGTLHLLE ADFPEGVLRR IERLQAHLCN PRGVAVSWLT GAIAVLEHPC ALGTSSGNNT RVKVFNSSMQ LIGQVDSFGL NLLFPSKITA SAVTFDHQGN VIVADTSGPA IVCLGKPEEF PALKPMVTHG LSRPVALVFT KENSLLVLDS ASHSIKVFKV MEGNGG. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase NHLRC1 (Nhlrc1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.