Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

NADH dehydrogenase [ubiquinone] flavoprotein 2 Recombinant Protein | NDUFV2 recombinant protein

Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

Gene Names
NDUFV2; CI-24k
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NADH dehydrogenase [ubiquinone] flavoprotein 2; Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2; mitochondrial; NADH-ubiquinone oxidoreductase 24 kDa subunit; NDUFV2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
35-249aa; Partial
Sequence
GGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
Sequence Length
249
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for NDUFV2 recombinant protein
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product Categories/Family for NDUFV2 recombinant protein
References
Mitochondrial NADH-ubiquinone reductase complementary DNA sequences of import precursors of the bovine and human 24-kDa subunit.Pilkington S.J., Walker J.E.Biochemistry 28:3257-3264(1989) The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.Murray J., Zhang B., Taylor S.W., Oglesbee D., Fahy E., Marusich M.F., Ghosh S.S., Capaldi R.A.J. Biol. Chem. 278:13619-13622(2003) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Mitochondrial c-Src regulates cell survival through phosphorylation of respiratory chain components.Ogura M., Yamaki J., Homma M.K., Homma Y.Biochem. J. 447:281-289(2012) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50.6 kDa
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase core subunit V2
NCBI Official Symbol
NDUFV2
NCBI Official Synonym Symbols
CI-24k
NCBI Protein Information
NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
UniProt Protein Name
NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
UniProt Gene Name
NDUFV2
UniProt Entry Name
NDUV2_HUMAN

NCBI Description

The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. This gene encodes the 24 kDa subunit of complex I, and is involved in electron transfer. Mutations in this gene are implicated in Parkinson's disease, bipolar disorder, schizophrenia, and have been found in one case of early onset hypertrophic cardiomyopathy and encephalopathy. A non-transcribed pseudogene of this locus is found on chromosome 19. [provided by RefSeq, Oct 2009]

Uniprot Description

NDUFV2: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I 24 kDa subunit family.

Protein type: Energy Metabolism - oxidative phosphorylation; Mitochondrial; Oxidoreductase; EC 1.6.99.3; EC 1.6.5.3

Chromosomal Location of Human Ortholog: 18p11.22

Cellular Component: mitochondrial inner membrane; mitochondrial respiratory chain complex I; mitochondrion; myelin sheath

Molecular Function: 2 iron, 2 sulfur cluster binding; electron carrier activity; metal ion binding; NADH dehydrogenase (ubiquinone) activity

Biological Process: cardiac muscle development; cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone; mitochondrial respiratory chain complex I assembly; nervous system development

Disease: Mitochondrial Complex I Deficiency

Research Articles on NDUFV2

Similar Products

Product Notes

The NDUFV2 ndufv2 (Catalog #AAA717229) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-249aa; Partial. The amino acid sequence is listed below: GGALFVHRDT PENNPDTPFD FTPENYKRIE AIVKNYPEGH KAAAVLPVLD LAQRQNGWLP ISAMNKVAEV LQVPPMRVYE VATFYTMYNR KPVGKYHIQV CTTTPCMLRN SDSILEAIQK KLGIKVGETT PDKLFTLIEV ECLGACVNAP MVQINDNYYE DLTAKDIEEI IDELKAGKIP KPGPRSGRFS CEPAGGLTSL TEPPKGPGFG VQAGL. It is sometimes possible for the material contained within the vial of "NADH dehydrogenase [ubiquinone] flavoprotein 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.