Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NEDD4 family-interacting protein 1 (NDFIP1) Recombinant Protein | NDFIP1 recombinant protein

Recombinant Human NEDD4 family-interacting protein 1 (NDFIP1)

Gene Names
NDFIP1; N4WBP5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NEDD4 family-interacting protein 1 (NDFIP1); Recombinant Human NEDD4 family-interacting protein 1 (NDFIP1); NDFIP1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-221aa; full length protein
Sequence
MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESG FPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFML TFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWL WWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for NDFIP1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,915 Da
NCBI Official Full Name
NEDD4 family-interacting protein 1
NCBI Official Synonym Full Names
Nedd4 family interacting protein 1
NCBI Official Symbol
NDFIP1
NCBI Official Synonym Symbols
N4WBP5
NCBI Protein Information
NEDD4 family-interacting protein 1
UniProt Protein Name
NEDD4 family-interacting protein 1
UniProt Gene Name
NDFIP1
UniProt Synonym Gene Names
N4WBP5
UniProt Entry Name
NFIP1_HUMAN

NCBI Description

The protein encoded by this gene belongs to a small group of evolutionarily conserved proteins with three transmembrane domains. It is a potential target for ubiquitination by the Nedd4 family of proteins. This protein is thought to be part of a family of integral Golgi membrane proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

NDFIP1: Activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, and consequently modulates the stability of their targets. As a result, controls many cellular processes. Prevents chronic T-helper cells-mediated inflammation by activating ITCH and thus controlling JUNB degradation. In cortical neurons, mediates the ubiquitination of SLC11A2/DMT1 by NEDD4L, leading to down-regulation of the divalent metal transporter and protection of the cells from cobalt and iron toxicity. Modulates EGFR signaling through multiple pathways. In particular, may regulate the ratio of AKT1-to-MAPK8 signaling in response to EGF, acting on AKT1 probably through PTEN destabilization and on MAPK8 through ITCH-dependent MAP2K4 inactivation. As a result, may control cell growth rate. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 5q31.3

Cellular Component: cell cortex; endosome membrane; extracellular region; Golgi membrane; integral to membrane; perinuclear region of cytoplasm

Molecular Function: protein binding; signal transducer activity

Biological Process: cellular iron ion homeostasis; metal ion transport; negative regulation of inflammatory response; negative regulation of interleukin-4 production; negative regulation of isotype switching to IgE isotypes; negative regulation of protein transport; negative regulation of T cell proliferation; negative regulation of T-helper 2 type immune response; negative regulation of transporter activity; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of protein catabolic process; positive regulation of protein ubiquitination; regulation of isotype switching to IgG isotypes; regulation of lymphocyte differentiation; regulation of myeloid leukocyte differentiation; signal transduction; ubiquitin-dependent protein catabolic process via the multivesicular body pathway; vacuolar transport

Research Articles on NDFIP1

Similar Products

Product Notes

The NDFIP1 ndfip1 (Catalog #AAA7022837) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-221aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the NDFIP1 ndfip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MALALAALAA VEPACGSRYQ QLQNEEESGE PEQAAGDAPP PYSSISAESA AYFDYKDESG FPKPPSYNVA TTLPSYDEAE RTKAEATIPL VPGRDEDFVG RDDFDDADQL RIGNDGIFML TFFMAFLFNW IGFFLSFCLT TSAAGRYGAI SGFGLSLIKW ILIVRFSTYF PGYFDGQYWL WWVFLVLGFL LFLRGFINYA KVRKMPETFS NLPRTRVLFI Y. It is sometimes possible for the material contained within the vial of "NEDD4 family-interacting protein 1 (NDFIP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.