N-acetylaspartate synthetase (nat8l) Recombinant Protein | nat8l recombinant protein

Recombinant Xenopus tropicalis N-acetylaspartate synthetase (nat8l)

• Gene Names: nat8l; cml3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: N-acetylaspartate synthetase (nat8l); Recombinant Xenopus tropicalis N-acetylaspartate synthetase (nat8l); Recombinant N-acetylaspartate synthetase (nat8l); N-acetylaspartate synthetase; NAA synthetase EC= 2.3.1.17; N-acetyltransferase 8-like protein; nat8l recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-271
• Sequence: MTYRGTRKSPCCSPPPRCGPPLPSGPAGSALGPPSSGAEEEMTKEQVYLREFQPADQEFARRIFYEGIKERILSSAFRGLKYQPLLQSVYAVIIIMCFVVTKSLLVTCCMPLFLLGMRYYYSRKIILNHLECALRTDMSDIEQYYMKQPGSCFWVAVLEGKVVGIVAARGNEEDNVVELRRMSVDSNYRGKGIAKALGRKVLEFAMLNHYSSIVLGTTAVKIAAHKLYESLGFKHVGVVEHHIVPGMTHSLLERLFFQLRYHRYCLQLREE
• Sequence Length: 271

• Species: Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 156717620
• NCBI GeneID: 100124940
• NCBI Accession #: NP_001096350.1
• NCBI GenBank Nucleotide #: NM_001102880.1
• UniProt Accession #: A4II32
• Molecular Weight: 30,726 Da
• NCBI Official Full Name: N-acetylaspartate synthetase
• NCBI Official Synonym Full Names: N-acetyltransferase 8-like (GCN5-related, putative)
• NCBI Official Symbol: nat8l
• NCBI Official Synonym Symbols: cml3
• NCBI Protein Information: N-acetylaspartate synthetase; camello 3; NAA synthetase; N-acetyltransferase 8-like protein
• UniProt Protein Name: N-acetylaspartate synthetase
• Protein Family: N-acetylaspartate synthetase
• UniProt Gene Name: nat8l
• UniProt Synonym Gene Names: NAA synthetase
• UniProt Entry Name: NAT8L_XENTR

Uniprot Description

Function: May play a role in the regulation of lipogenesis by producing N-acetylaspartate acid (NAA), a brain-specific metabolite. May promote dopamine uptake by regulating TNF-alpha expression

By similarity.

Catalytic activity: Acetyl-CoA + L-aspartate = CoA + N-acetyl-L-aspartate.

Subcellular location: Cytoplasm

By similarity. Membrane; Single-pass membrane protein

Potential. Microsome membrane; Single-pass membrane protein

By similarity. Mitochondrion membrane; Single-pass membrane protein

By similarity. Rough endoplasmic reticulum membrane; Single-pass membrane protein

By similarity.

Sequence similarities: Belongs to the camello family.Contains 1 N-acetyltransferase domain.