Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable N-acetyltransferase 8B (NAT8B) Recombinant Protein | NAT8B recombinant protein

Recombinant Human Probable N-acetyltransferase 8B (NAT8B)

Gene Names
NAT8B; CML2; Hcml2; NAT8BP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable N-acetyltransferase 8B (NAT8B); Recombinant Human Probable N-acetyltransferase 8B (NAT8B); NAT8B recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-227aa; full length protein
Sequence
MAPYHIRKYQESDRKSVVGLLSGGMAEHAPATFRRLLKLPRTLILLLGGALALLLVSGSW ILALVFSLSLLPALWFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVAESEEKVVG TVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSNI QLSAMGLYQSLGFKKTGQSFFHVWARLVDLHTVHFIYHLPSAQAGRL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for NAT8B recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,366 Da
NCBI Official Full Name
putative N-acetyltransferase 8B
NCBI Official Synonym Full Names
N-acetyltransferase 8B (putative, gene/pseudogene)
NCBI Official Symbol
NAT8B
NCBI Official Synonym Symbols
CML2; Hcml2; NAT8BP
NCBI Protein Information
putative N-acetyltransferase 8B
UniProt Protein Name
Putative N-acetyltransferase 8B
UniProt Gene Name
NAT8B
UniProt Synonym Gene Names
ATase1
UniProt Entry Name
NAT8B_HUMAN

NCBI Description

The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in the vicinity of the NAT8 gene and may represent a pseudogene of NAT8. This gene contains two polymorphic nonsense mutations that disrupt the active site of the protein. The full-length product of this gene contains a complete acetyltransferase domain and is identical in length to NAT8. [provided by RefSeq, Jul 2008]

Uniprot Description

NAT8B: May play a role in regulation of gastrulation. Belongs to the camello family.

Protein type: Acetyltransferase; EC 2.3.1.-; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p13.1

Cellular Component: endoplasmic reticulum membrane; ER-Golgi intermediate compartment; ER-Golgi intermediate compartment membrane; integral to membrane

Molecular Function: lysine N-acetyltransferase activity; N-acetyltransferase activity; protein binding

Biological Process: beta-amyloid metabolic process; cellular protein metabolic process; gastrulation with mouth forming second; negative regulation of apoptosis; peptidyl-lysine N6-acetylation

Research Articles on NAT8B

Similar Products

Product Notes

The NAT8B nat8b (Catalog #AAA7022667) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-227aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the NAT8B nat8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAPYHIRKYQ ESDRKSVVGL LSGGMAEHAP ATFRRLLKLP RTLILLLGGA LALLLVSGSW ILALVFSLSL LPALWFLAKK PWTRYVDIAL RTDMSDITKS YLSECGSCFW VAESEEKVVG TVGALPVDDP TLREKRLQLF HLSVDNEHRG QGIAKALVRT VLQFARDQGY SEVVLDTSNI QLSAMGLYQS LGFKKTGQSF FHVWARLVDL HTVHFIYHLP SAQAGRL. It is sometimes possible for the material contained within the vial of "Probable N-acetyltransferase 8B (NAT8B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.