Nanog-TAT recombinant protein
Human Nanog-TAT
Purity
>95% pure ( SDS-PAGE, Coomassie blue stain)
Synonyms
Nanog-TAT; Human Nanog-TAT; Nanog-TAT recombinant protein
Host
E Coli
Specificity
>95% pure ( SDS-PAGE, Coomassie blue stain)
Purity/Purification
>95% pure ( SDS-PAGE, Coomassie blue stain)
Form/Format
Purified, Liquid, filtered for cell culture. PBS with 50mM arginine
Concentration
1.3mg/ml (lot 11/2017) (varies by lot)
Sequence
HMGPSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQNGGYGRKKRRQRRRLE
Application Notes
Stem Cell Study
Species
Human
Protein Structure
Recombinant Human Nanog-TAT is a 36.1kDa protein, which is synthesized as a 304 amino acid polypeptide plus a 13- residue C-terminal TAT peptide.
Important Note
Centrifuge before opening to ensure complete recovery of vial contents.
Preparation and Storage
Store at 4 degree C for short time only, aliquote to avoid repeated freezing and thawing, store at -20 degree C.
Related Product Information for Nanog-TAT recombinant protein
Nanog is a regulatory protein that is associated with undifferentiated pluripotent cells. The expression of nanog, which is suppressed in all adult tissues, is restricted to embryonic stem cells and to certain pluripotent cancer cells. Decreased expression of nanog is strongly correlated with cell differentiation. Nanog, most likely, acts as an intracellular regulator, that helps maintain pluripotency and self renewal via a STAT3-independent pathway. The introduction of nanog, along with Sox2, Oct4, and Lin28, into primary human fibroblasts was sufficient to confer a pluripotent state upon the fibroblast genome. The reprogrammed cells thus obtained resemble ESC in morphology and gene expression. Protein transduction using TAT fusion proteins represents an alternative methodology for introducing transcription factors into primary, as well as transformed, cells.
Product Categories/Family for Nanog-TAT recombinant protein
Similar Products
Product Notes
The Nanog-TAT (Catalog #AAA596159) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. Stem Cell Study. Researchers should empirically determine the suitability of the Nanog-TAT for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HMGPSVSNQQ FAGGCAKAAE EAPEEAPEDA ARAADEPQLL HGAGICKWFN VRMGFGFLSM TARAGVALDP PVDVFVHQSK LHMEGFRSLK EGEAVEFTFK KSAKGLESIR VTGPGGVFCI GSERRPKKSM QKRRSKGDRC YNCGGLDHHA KECKLPPQPK KCHFCQSISH MVASCPLKAQ QGPSAQGKPT YFREEEEEIH SPTLLPEAQN GGYGRKKRRQ RRRLE. It is sometimes possible for the material contained within the vial of "Nanog-TAT, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
