Protein ATAF2 (NAC081) Recombinant Protein | NAC081 recombinant protein

Recombinant Arabidopsis thaliana Protein ATAF2 (NAC081)

Cat. Num. AAA1279779

• Gene Names: ATAF2; anac081; Arabidopsis NAC domain containing protein 81
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein ATAF2 (NAC081); Recombinant Arabidopsis thaliana Protein ATAF2 (NAC081); NAC081 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-283, Full length protein
• Sequence: MKSELNLPAGFRFHPTDEELVKFYLCRKCASEQISAPVIAEIDLYKFNPWELPEMSLYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGKPKTLGIKKALVFYAGKAPKGIKTNWIMHEYRLANVDRSASVNKKNNLRLDDWVLCRIYNKKGTMEKYFPADEKPRTTTMAEQSSSPFDTSDSTYPTLQEDDSSSSGGHGHVVSPDVLEVQSEPKWGELEDALEAFDTSMFGSSMELLQPDAFVPQFLYQSDYFTSFQDPPEQKPFLNWSFAPQG
• Sequence Length: 283

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 22326685
• NCBI GeneID: 830779
• NCBI Accession #: NP_680161.1
• NCBI GenBank Nucleotide #: NM_147856.4
• UniProt Accession #: Q9C598; Q38968; Q8GWD8
• Molecular Weight: 17,499 Da
• NCBI Official Full Name: NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
• NCBI Official Symbol: ATAF2
• NCBI Official Synonym Symbols: anac081; Arabidopsis NAC domain containing protein 81
• NCBI Protein Information: NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
• UniProt Protein Name: Protein ATAF2
• Protein Family: Protein
• UniProt Gene Name: NAC081
• UniProt Synonym Gene Names: ATAF2; ANAC081

NCBI Description

induced by wounding, belongs to a large family of putative transcriptional activators with NAC domain.

Uniprot Description

Involved in disease resistance response (PubMed:16115070, PubMed:19625399). May function as repressor of pathogenesis-related proteins (PubMed:16115070). May function in the regulation of host basal defense responses against viral infection (PubMed:19625399). Transcriptional activator involved in responses to wounding and infection with tobamovirus (TMV) (PubMed:22937923). Binds to the DNA sequences 5'-AAAATATCT-3' and 5'AGATTTTT-3' of CYP734A1/BAS1 and CYP72C1/SOB7 promoters, respectively. Acts as suppressor of the brassinosteroid (BR)-inactivating enzymes CYP734A1/BAS1 and CYP72C1/SOB7, and prevents their expression in almost all tissues. Plays a central role in integrating BR homeostasis and seedling development. Regulates the spatial regulation of BR homeostasis and participates in the regulation of hypocotyl elongation and root growth by suppressing BR catabolism. Mediates connection between BR catabolism and photomorphogenesis (PubMed:26493403). Binds to, and transactivates the promoter of the auxin biosynthetic gene NIT2 (PubMed:22965747). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494).