SOSS complex subunit B2 (obfc2a) Recombinant Protein | obfc2a recombinant protein
Recombinant Danio rerio SOSS complex subunit B2 (obfc2a)
Gene Names
nabp1a; nabp1; obfc2a; obfc2aa; wu:fc60e10; wu:fi33c08; zgc:101644
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
SOSS complex subunit B2 (obfc2a); Recombinant Danio rerio SOSS complex subunit B2 (obfc2a); obfc2a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-211, Full length protein
Sequence
MSNISNEAVILIKDVKPGSKNLNIVFIVLEIGRVTKTKDGHEVRSCRVADKSGSIAISVWDELGSLIQPGDIIRLTRGYASIWKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPELLAQANQQNKTSKEQRGNSPPNQNAGNGTVPVFSNNNAAPVPRDPNFGASGRPNGRAPGNGPPPVTAGGTPAPPKPTVSISNGRDPRRASKR
Sequence Length
211
Species
Zebrafish
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,438 Da
NCBI Official Full Name
SOSS complex subunit B2
NCBI Official Synonym Full Names
nucleic acid binding protein 1a
NCBI Official Symbol
nabp1a
NCBI Official Synonym Symbols
nabp1; obfc2a; obfc2aa; wu:fc60e10; wu:fi33c08; zgc:101644
NCBI Protein Information
SOSS complex subunit B2
UniProt Protein Name
SOSS complex subunit B2
UniProt Gene Name
nabp1
UniProt Synonym Gene Names
obfc2a; ssb2; SOSS-B2
Uniprot Description
Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) ().
Similar Products
Product Notes
The obfc2a nabp1 (Catalog #AAA1339879) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-211, Full length protein. The amino acid sequence is listed below: MSNISNEAVI LIKDVKPGSK NLNIVFIVLE IGRVTKTKDG HEVRSCRVAD KSGSIAISVW DELGSLIQPG DIIRLTRGYA SIWKGCLTLY TGRGGDLQKI GEFCMVYSEV PNFSEPNPEL LAQANQQNKT SKEQRGNSPP NQNAGNGTVP VFSNNNAAPV PRDPNFGASG RPNGRAPGNG PPPVTAGGTP APPKPTVSIS NGRDPRRASK R. It is sometimes possible for the material contained within the vial of "SOSS complex subunit B2 (obfc2a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
