Myosin light chain kinase, smooth muscle (MYLK) Recombinant Protein | MYLK recombinant protein
Recombinant Pig Myosin light chain kinase, smooth muscle (MYLK)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Myosin light chain kinase; smooth muscle (MYLK); Recombinant Pig Myosin light chain kinase; MYLK recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-139, Full length protein
Sequence
FIVLSQEGSLCSISIEKALPEDRGLYKCVAKNSAGQAECSCQVTVDDAPTGENAKAPEMKARRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVAGTQPITCTWMKFRKQIQES
Sequence Length
139
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MYLK recombinant protein
This gene, a muscle member of the immunoglobulin gene superfamily, encodes myosin light chain kinase which is a calcium
calmodulin dependent enzyme. This kinase phosphorylates myosin regulatory light chains to facilitate myosin interaction with actin filaments to produce contractile activity. This gene encodes both smooth muscle and nonmuscle isoforms. In addition, using a separate promoter in an intron in the 3 region, it encodes telokin, a small protein identical in sequence to the C-terminus of myosin light chain kinase, that is independently expressed in smooth muscle and functions to stabilize unphosphorylated myosin filaments. A pseudogene is located on the p arm of chromosome 3. Four transcript variants that produce four isoforms of the calcium
calmodulin dependent enzyme have been identified as well as two transcripts that produce two isoforms of telokin. Additional variants have been identified but lack full length transcripts.
calmodulin dependent enzyme. This kinase phosphorylates myosin regulatory light chains to facilitate myosin interaction with actin filaments to produce contractile activity. This gene encodes both smooth muscle and nonmuscle isoforms. In addition, using a separate promoter in an intron in the 3 region, it encodes telokin, a small protein identical in sequence to the C-terminus of myosin light chain kinase, that is independently expressed in smooth muscle and functions to stabilize unphosphorylated myosin filaments. A pseudogene is located on the p arm of chromosome 3. Four transcript variants that produce four isoforms of the calcium
calmodulin dependent enzyme have been identified as well as two transcripts that produce two isoforms of telokin. Additional variants have been identified but lack full length transcripts.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
15,000 Da
NCBI Official Full Name
Myosin light chain kinase, smooth muscle
NCBI Official Symbol
MYLK
NCBI Protein Information
myosin light chain kinase, smooth muscle
UniProt Protein Name
Myosin light chain kinase, smooth muscle
Protein Family
UniProt Gene Name
MYLK
UniProt Synonym Gene Names
MLCK
Uniprot Description
Phosphorylates a specific serine in the N-terminus of a myosin light chain. Also regulates actin-myosin interaction through a non-kinase activity ().
