Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transcription factor MYC2 (RAP1) Recombinant Protein | RAP1 recombinant protein

Recombinant Arabidopsis thaliana Transcription factor MYC2 (RAP1) , partial

Gene Names
MYC2; ATMYC2; F6N18.4; F6N18_4; JAI1; JASMONATE INSENSITIVE 1; JIN1; RD22BP1; ZBF1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription factor MYC2 (RAP1); Recombinant Arabidopsis thaliana Transcription factor MYC2 (RAP1); partial; RAP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
446-525. Partial, covers the bHLH Domain
Sequence
GREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEEVKLELAGR
Sequence Length
525
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67,950 Da
NCBI Official Full Name
Basic helix-loop-helix (bHLH) DNA-binding family protein
NCBI Official Symbol
MYC2
NCBI Official Synonym Symbols
ATMYC2; F6N18.4; F6N18_4; JAI1; JASMONATE INSENSITIVE 1; JIN1; RD22BP1; ZBF1
NCBI Protein Information
Basic helix-loop-helix (bHLH) DNA-binding family protein
UniProt Protein Name
Transcription factor MYC2
Protein Family
UniProt Gene Name
MYC2
UniProt Synonym Gene Names
BHLH6; EN38; JAI1; JIN1; RAP1; RD22BP1; ZBF1; AtMYC2; AtbHLH6; bHLH 6; RAP-1

NCBI Description

Encodes a MYC-related transcriptional activator with a typical DNA binding domain of a basic helix-loop-helix leucine zipper motif. Binds to an extended G-Box promoter motif and interacts with Jasmonate ZIM-domain proteins. Its transcription is induced by dehydration stress and ABA treatment. Negative regulator of blue light#Aeimediated photomorphogenic growth and blue and far-red-light#Aeiregulated gene expression. Positive regulator of lateral root formation. Regulates diverse JA-dependent functions. Negatively regulates Trp metabolism and biosynthesis of Trp-derived secondary metabolites. Positively regulates flavonoid biosynthesis, resistance to insects, and response to oxidative stress. Regulates other transcription factors, and negatively regulates its own expression.

Uniprot Description

Transcriptional activator. Common transcription factor of light, abscisic acid (ABA), and jasmonic acid (JA) signaling pathways. With MYC3 and MYC4, controls additively subsets of JA-dependent responses. In cooperation with MYB2 is involved in the regulation of ABA-inducible genes under drought stress conditions. Can form complexes with all known glucosinolate-related MYBs to regulate glucosinolate biosynthesis. Binds to the MYC recognition site (5'-CACATG-3'), and to the G-box (5'-CACNTG-3') and Z-box (5'-ATACGTGT-3') of promoters. Binds directly to the promoters of the transcription factors PLETHORA1 (PLT1) and PLT2 and represses their expression. Negative regulator of blue light-mediated photomorphogenic growth and blue- and far-red-light regulated gene expression. Activates multiple TIFY/JAZ promoters. Positive regulator of lateral root formation. Regulates sesquiterpene biosynthesis. Subjected to proteasome-dependent proteolysis. The presence of the destruction element (DE) involved in turnover is required for the function to regulate gene transcription.

Research Articles on RAP1

Similar Products

Product Notes

The RAP1 myc2 (Catalog #AAA1398100) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 446-525. Partial, covers the bHLH Domain. The amino acid sequence is listed below: GREEPLNHVE AERQRREKLN QRFYALRAVV PNVSKMDKAS LLGDAIAYIN ELKSKVVKTE SEKLQIKNQL EEVKLELAGR. It is sometimes possible for the material contained within the vial of "Transcription factor MYC2 (RAP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.