Mucin-2 (Muc2) Recombinant Protein | Muc2 recombinant protein
Recombinant Rat Mucin-2 (Muc2) , partial
Gene Names
Muc2; MLP; HH-Muc
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mucin-2 (Muc2); Recombinant Rat Mucin-2 (Muc2); partial; Muc2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
33-237. Partial, provide the VWFD 1 Domain
Sequence
VCSTWGDFHYKTFDGDVFRFPGLCDYNFASDCRDSYKEFAVHLKRGLDKAGGHSSIESVLITIKDDTIYLTHKLAVVNGAMVSTPHYSSGLLIEKNDAYTKVYSRAGLSLMWNREDALMVELDGRFQNHTCGLCGDFNGMQANNEFLSDGIRFSAIEFGNMQKINKPEVVCEDPEEVQEPESCSEHRAECERLLTSTAFEDCQAR
Sequence Length
237
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Muc2 recombinant protein
This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. This protein is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
166,038 Da
NCBI Official Full Name
Mucin-2
NCBI Official Synonym Full Names
mucin 2, oligomeric mucus/gel-forming
NCBI Official Symbol
Muc2
NCBI Official Synonym Symbols
MLP; HH-Muc
NCBI Protein Information
mucin-2; LOW QUALITY PROTEIN: mucin-2; intestinal mucin-like protein
UniProt Protein Name
Mucin-2
Protein Family
UniProt Gene Name
Muc2
UniProt Synonym Gene Names
MUC-2
NCBI Description
an intestinal secretory mucin which forms dimers [RGD, Feb 2006]
Uniprot Description
Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer ().
Research Articles on Muc2
Similar Products
Product Notes
The Muc2 muc2 (Catalog #AAA1385866) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 33-237. Partial, provide the VWFD 1 Domain. The amino acid sequence is listed below: VCSTWGDFHY KTFDGDVFRF PGLCDYNFAS DCRDSYKEFA VHLKRGLDKA GGHSSIESVL ITIKDDTIYL THKLAVVNGA MVSTPHYSSG LLIEKNDAYT KVYSRAGLSL MWNREDALMV ELDGRFQNHT CGLCGDFNGM QANNEFLSDG IRFSAIEFGN MQKINKPEVV CEDPEEVQEP ESCSEHRAEC ERLLTSTAFE DCQAR . It is sometimes possible for the material contained within the vial of "Mucin-2 (Muc2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
