G-protein coupled receptor Mth (mth) Recombinant Protein | mth recombinant protein

Recombinant Drosophila melanogaster G-protein coupled receptor Mth (mth)

• Gene Names: mth; CG6936; DmelCG6936; Mth; MTH
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: G-protein coupled receptor Mth (mth); Recombinant Drosophila melanogaster G-protein coupled receptor Mth (mth); Recombinant G-protein coupled receptor Mth (mth); G-protein coupled receptor Mth; Protein methuselah; mth recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 25-514
• Sequence: DILECDYFDTVDISAAQKLQNGSYLFEGLLVPAILTGEYDFRILPDDSKQKVARHIRGCVCKLKPCVRFCCPHDHIMDNGVCYDNMSDEELAELDPFLNVTLDDGSVSRRHFKNELIVQWDLPMPCDGMFYLDNREEQDKYTLFENGTFFRHFDRVTLRKREYCLQHLTFADGNATSIRIAPHNCLIVPSITGQTVVMISSLICMVLTIAVYLFVKKLQNLHGKCFICYMVCLFMGYLFLLLDLWQISISFCKPAGFLGYFFVMAAFFWLSVISLHLWNTFRGSSHKANRFLFEHRFLAYNTYAWGMAVVLTGITVLADNIVENQDWNPRVGHEGHCWIYTQAWSAMLYFYGPMVFLIAFNITMFILTAKRILGVKKDIQNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSYFSQSNQTWANVFLVADYLNWSQGIIIFILFVLKRSTWRLLQESIRGEGEEVNNSEEEISLENTTTRNVLL
• Sequence Length: 514

• Species: Drosophila melanogaster (Fruit fly)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 281365383
• NCBI GeneID: 38058
• NCBI Accession #: NP_001163311.1
• NCBI GenBank Nucleotide #: NM_001169840.1
• UniProt Accession #: O97148; Q9GN21; Q9GN78; Q9GND6; Q9GNE8; Q9GT57; Q9GT58; Q9GT59; Q9GT60; Q9W0R4; B5RJF9
• Molecular Weight: 59,644 Da
• NCBI Official Full Name: methuselah, isoform C
• NCBI Official Synonym Full Names: methuselah
• NCBI Official Symbol: mth
• NCBI Official Synonym Symbols: CG6936; DmelCG6936; Mth; MTH
• NCBI Protein Information: CG6936 gene product from transcript CG6936-RE; CG6936-PA; CG6936-PB; CG6936-PC; CG6936-PD; CG6936-PE; methusalah; methuselah; mth-PA; mth-PB; mth-PC; mth-PD; mth-PE
• UniProt Protein Name: G-protein coupled receptor Mth
• Protein Family: G-protein coupled receptor
• UniProt Gene Name: mth
• UniProt Entry Name: MTH_DROME

Uniprot Description

Function: Involved in biological aging and stress response. Essential for adult survival. Required in the presynaptic motor neuron to up-regulate neurotransmitter exocytosis at larval glutamatergic neuromuscular junctions (NMJs). Regulates a step associated with docking and clustering of vesicles at release sites. Sun, Acp70A/SP and eys/SPAM are agonists that activate mth. Ref.1 Ref.7

Subunit structure: Homodimer. Interacts with sun, Acp70A/SP and eys/SPAM. Ref.8 Ref.9

Subcellular location: Cell membrane; Multi-pass membrane protein. Note: Plasma membrane of presynaptic terminals and innervating axons. Ref.7

Disruption phenotype: Increase in average life-span and enhanced resistance to various forms of stress, including starvation, high temperature and dietary paraquat, a free-radical generator. Ref.1

Miscellaneous: Agonists of mth share minimal sequence homology, suggesting a remarkable promiscuity of mth for activation.

Sequence similarities: Belongs to the G-protein coupled receptor 2 family. Mth subfamily.

Sequence caution: The sequence AAG22708.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22709.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22710.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22711.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22712.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22713.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22714.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22715.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22716.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22717.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22718.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22719.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22720.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22721.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22722.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22723.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22724.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22725.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22726.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22727.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22728.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22729.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22730.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22731.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22732.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22733.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22734.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22735.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22736.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22737.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAG22738.1 differs from that shown. Reason: Erroneous gene model prediction.