GTP-binding protein 5 (GTPBP5) Recombinant Protein | GTPBP5 recombinant protein
Recombinant Human GTP-binding protein 5 (GTPBP5)
Gene Names
MTG2; ObgH1; GTPBP5; dJ1005F21.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GTP-binding protein 5 (GTPBP5); Recombinant Human GTP-binding protein 5 (GTPBP5); GTPBP5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-406, Full length protein
Sequence
MAPARCFSARLRTVFQGVGHWALSTWAGLKPSRLLPQRASPRLLSVGRADLAKHQELPGKKLLSEKKLKRYFVDYRRVLVCGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPVTCTPGQPGQQRVLHLELKTVAHAGMVGFPNAGKSSLLRAISNARPAVASYPFTTLKPHVGIVHYEGHLQIAVADIPGIIRGAHQNRGLGSAFLRHIERCRFLLFVVDLSQPEPWTQVDDLKYELEMYEKGLSARPHAIVANKIDLPEAQANLSQLRDHLGQEVIVLSALTGENLEQLLLHLKVLYDAYAEAELGQGRQPLRW
Sequence Length
406
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19,820 Da
NCBI Official Full Name
mitochondrial ribosome-associated GTPase 2
NCBI Official Synonym Full Names
mitochondrial ribosome associated GTPase 2
NCBI Official Symbol
MTG2
NCBI Official Synonym Symbols
ObgH1; GTPBP5; dJ1005F21.2
NCBI Protein Information
mitochondrial ribosome-associated GTPase 2
UniProt Protein Name
Mitochondrial ribosome-associated GTPase 2
UniProt Gene Name
MTG2
UniProt Synonym Gene Names
GTPBP5; OBGH1; ObgH1
NCBI Description
Small G proteins, such as GTPBP5, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIM, Mar 2008]
Uniprot Description
Plays a role in the regulation of the mitochondrial ribosome assembly and of translational activity. Displays GTPase activity. Involved in the ribosome maturation process.
Research Articles on GTPBP5
Similar Products
Product Notes
The GTPBP5 mtg2 (Catalog #AAA1364430) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-406, Full length protein. The amino acid sequence is listed below: MAPARCFSAR LRTVFQGVGH WALSTWAGLK PSRLLPQRAS PRLLSVGRAD LAKHQELPGK KLLSEKKLKR YFVDYRRVLV CGGNGGAGAS CFHSEPRKEF GGPDGGDGGN GGHVILRVDQ QVKSLSSVLS RYQGFSGEDG GSKNCFGRSG AVLYIRVPVG TLVKEGGRVV ADLSCVGDEY IAALGGAGGK GNRFFLANNN RAPVTCTPGQ PGQQRVLHLE LKTVAHAGMV GFPNAGKSSL LRAISNARPA VASYPFTTLK PHVGIVHYEG HLQIAVADIP GIIRGAHQNR GLGSAFLRHI ERCRFLLFVV DLSQPEPWTQ VDDLKYELEM YEKGLSARPH AIVANKIDLP EAQANLSQLR DHLGQEVIVL SALTGENLEQ LLLHLKVLYD AYAEAELGQG RQPLRW. It is sometimes possible for the material contained within the vial of "GTP-binding protein 5 (GTPBP5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
