ATP synthase subunit a (Mtatp6) Recombinant Protein | mt-Atp6 recombinant protein

Recombinant Mouse ATP synthase subunit a (Mtatp6)

• Gene Names: mt-Atp6; ATP6
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATP synthase subunit a (Mtatp6); Recombinant Mouse ATP synthase subunit a (Mtatp6); Recombinant ATP synthase subunit a (Mtatp6); ATP synthase subunit a; F-ATPase protein 6; mt-Atp6 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-226
• Sequence: MNENLFASFITPTMMGFPIVVAIIMFPSILFPSSKRLINNRLHSFQHWLVKLIIKQMMLIHTPKGRTWTLMIVSLIMFIGSTNLLGLLPHTFTPTTQLSMNLSMAIPLWAGAVITGFRHKLKSSLAHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLVLMNISPPTATITFIILLLLTILEFAVALIQAYVFTLLVSLYLHDNT
• Sequence Length: 226

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 34538603
• NCBI GeneID: 17705
• NCBI Accession #: NP_904333.1
• NCBI GenBank Nucleotide #: NC_005089.1
• UniProt Accession #: P00848; 0806162A
• Molecular Weight: 25,096 Da
• NCBI Official Full Name: ATP synthase F0 subunit 6
• NCBI Official Synonym Full Names: ATP synthase 6, mitochondrial
• NCBI Official Symbol: mt-Atp6
• NCBI Official Synonym Symbols: ATP6
• NCBI Protein Information: ATP synthase F0 subunit 6
• UniProt Protein Name: ATP synthase subunit a
• UniProt Gene Name: Mtatp6
• UniProt Synonym Gene Names: Atp6; Atpase6; mt-Atp6
• UniProt Entry Name: ATP6_MOUSE

Uniprot Description

ATP6: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane. Defects in MT-ATP6 are the cause of neurogenic muscle weakness, ataxia, and retinitis pigmentosa (NARP). Defects in MT-ATP6 are a cause of Leber hereditary optic neuropathy (LHON). LHON is a maternally inherited disease resulting in acute or subacute loss of central vision, due to optic nerve dysfunction. Cardiac conduction defects and neurological defects have also been described in some patients. LHON results from primary mitochondrial DNA mutations affecting the respiratory chain complexes. Defects in MT-ATP6 are a cause of Leigh syndrome (LS). LS is a severe neurological disorder characterized by bilaterally symmetrical necrotic lesions in subcortical brain regions. Defects in MT-ATP6 are a cause of mitochondrial infantile bilateral striatal necrosis (MIBSN). Bilateral striatal necrosis is a neurological disorder resembling Leigh syndrome. Belongs to the ATPase A chain family.

Protein type: Transporter, ion channel; Membrane protein, multi-pass; Transporter; Membrane protein, integral; Mitochondrial

Cellular Component: mitochondrion; membrane; proton-transporting ATP synthase complex, coupling factor F(o); mitochondrial inner membrane; integral to membrane

Molecular Function: hydrogen ion transmembrane transporter activity

Biological Process: ATP synthesis coupled proton transport; proton transport; transport; ATP biosynthetic process; ion transport