Protein mss51 (mss51) Recombinant Protein | mss51 recombinant protein
Recombinant Schizosaccharomyces pombe Protein mss51 (mss51)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein mss51 (mss51); Recombinant Schizosaccharomyces pombe Protein mss51 (mss51); mss51 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-378, Full length
Sequence
MSFLKNLFKKKSPTHELFHPLSRSPLTALRRRSEHIKQVYRCPISGKSVEYECPESGFPTHCNRTHWEQDKIHQSLIPKLRQINEDYHDLARPNPLPELLKLPGPMEEDEVVSLLSWDSFFYTRDFPKFQSSRTARHITSLLTYPMSIGAILHKNSPYNLKNGLTPQGLQSLTALRYMLHRPLSAQSTDPRPTRIFVLGATKECSLPPSIWLQGLNFLFPGRLFQLHFIGPEVVVPSKQPNLPSPLSLHFHQDYYHNLHRVGAFEPFDPYYDTFFLPMPLISHPLYSSSWIPTLHDLVSTRCSVWLTSPSSQRTTKDLEVLNNVLKDSIEPLLLPTVNKFASLGWSVDDSNLHEVYHANQEVFGFRALYYNVQNVSKE
Sequence Length
378
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,600 Da
NCBI Official Full Name
mitochondrial splicing suppressor Mss51 (predicted)
NCBI Official Symbol
mss51
NCBI Protein Information
mitochondrial splicing suppressor Mss51 (predicted)
UniProt Protein Name
Protein mss51
Protein Family
UniProt Gene Name
mss51
Uniprot Description
Has a dual role in the assembly of cytochrome oxidase subunit 1 (cox1). It has a regulative function on cox1 synthesis, acting as a translational activator specific for the cox1 mRNA, and it also binds to newly synthesized cox1 protein ().
Similar Products
Product Notes
The mss51 mss51 (Catalog #AAA1280477) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-378, Full length. The amino acid sequence is listed below: MSFLKNLFKK KSPTHELFHP LSRSPLTALR RRSEHIKQVY RCPISGKSVE YECPESGFPT HCNRTHWEQD KIHQSLIPKL RQINEDYHDL ARPNPLPELL KLPGPMEEDE VVSLLSWDSF FYTRDFPKFQ SSRTARHITS LLTYPMSIGA ILHKNSPYNL KNGLTPQGLQ SLTALRYMLH RPLSAQSTDP RPTRIFVLGA TKECSLPPSI WLQGLNFLFP GRLFQLHFIG PEVVVPSKQP NLPSPLSLHF HQDYYHNLHR VGAFEPFDPY YDTFFLPMPL ISHPLYSSSW IPTLHDLVST RCSVWLTSPS SQRTTKDLEV LNNVLKDSIE PLLLPTVNKF ASLGWSVDDS NLHEVYHANQ EVFGFRALYY NVQNVSKE. It is sometimes possible for the material contained within the vial of "Protein mss51 (mss51), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
