Sulfoxide reductase heme-binding subunit YedZ (yedZ) Recombinant Protein | yedZ recombinant protein
Recombinant Salmonella paratyphi C Sulfoxide reductase heme-binding subunit YedZ (yedZ)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sulfoxide reductase heme-binding subunit YedZ (yedZ); Recombinant Salmonella paratyphi C Sulfoxide reductase heme-binding subunit YedZ (yedZ); yedZ recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-199aa; full length protein
Sequence
MRLTAKQITWLKVCLHLAGFLPLLWLFWAINHGGLSADPVKDIQHFTGRTALKFLLATLL VSPLARYAKQPLLIRTRRLLGLWCFVWATLHLTSYALLELGIHNLALLGSELISRPYLTL GIISWLVLLALTLTSTQFAQRKLGKRWQTLHNVVYLVAILAPIHYLWSVKILSPQPVIYA ALALALLALRYRKFRQWWR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Salmonella paratyphi C (strain RKS4594)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for yedZ recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,868 Da
NCBI Official Full Name
sulfoxide reductase heme-binding subunit YedZ
UniProt Protein Name
Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ
UniProt Gene Name
msrQ
UniProt Entry Name
MSRQ_SALPC
Uniprot Description
Part of the MsrPQ system that repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O), using respiratory chain electrons. Thus protects these proteins from oxidative-stress damage caused by reactive species of oxygen and chlorine generated by the host defense mechanisms. MsrPQ is essential for the maintenance of envelope integrity under bleach stress, rescuing a wide series of structurally unrelated periplasmic proteins from methionine oxidation, including the primary periplasmic chaperone SurA and the lipoprotein Pal. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, using the quinone pool of the respiratory chain.
Similar Products
Product Notes
The yedZ msrq (Catalog #AAA7034304) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-199aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the yedZ msrq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRLTAKQITW LKVCLHLAGF LPLLWLFWAI NHGGLSADPV KDIQHFTGRT ALKFLLATLL VSPLARYAKQ PLLIRTRRLL GLWCFVWATL HLTSYALLEL GIHNLALLGS ELISRPYLTL GIISWLVLLA LTLTSTQFAQ RKLGKRWQTL HNVVYLVAIL APIHYLWSVK ILSPQPVIYA ALALALLALR YRKFRQWWR. It is sometimes possible for the material contained within the vial of "Sulfoxide reductase heme-binding subunit YedZ (yedZ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
