Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Sulfoxide reductase catalytic subunit YedY (yedY) Recombinant Protein | yedY recombinant protein

Recombinant Pseudomonas aeruginosa Sulfoxide reductase catalytic subunit YedY (yedY)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sulfoxide reductase catalytic subunit YedY (yedY); Recombinant Pseudomonas aeruginosa Sulfoxide reductase catalytic subunit YedY (yedY); yedY recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
49-337, Full length protein
Sequence
DEQRYAGVESVPAPGWFAEKLPQTRWQAVNVQGEAITPFKDATHYNNFYEFGPNKGDPAENASALKAEPWSVVIDGEVGKPGTYALEDFVKPYQLEERIYRLRCVEAWSMVIPWLGFPLADLLKRVEPNGQAKFVRFETLQRPEQMVGQRSGFSVIDWPYMEGLRMDEAMHPLAILAVGMYGRLLPNQNGAPLRLVVPWKYGFKSIKSIVRISLVREQPKTTWESIAANEYGFYANVNPQVDHPRWSQARERRLPSGLFSPNVRDTQMFNGYGSEVASLYSGMDLRKYY
Sequence Length
289
Species
Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,144 Da
NCBI Official Full Name
sulfite oxidase subunit YedY
NCBI Official Symbol
PA4692
NCBI Protein Information
sulfite oxidase subunit YedY
UniProt Protein Name
Protein-methionine-sulfoxide reductase catalytic subunit MsrP
UniProt Gene Name
msrP

Uniprot Description

Part of the MsrPQ system that repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O), using respiratory chain electrons. Thus protects these proteins from oxidative-stress damage caused by reactive species of oxygen and chlorine generated by the host defense mechanisms. MsrPQ is essential for the maintenance of envelope integrity under bleach stress, rescuing a wide series of structurally unrelated periplasmic proteins from methionine oxidation. The catalytic subunit MsrP is non-stereospecific, being able to reduce both (R-) and (S-) diastereoisomers of methionine sulfoxide.

Similar Products

Product Notes

The yedY msrp (Catalog #AAA1425218) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 49-337, Full length protein. The amino acid sequence is listed below: DEQRYAGVES VPAPGWFAEK LPQTRWQAVN VQGEAITPFK DATHYNNFYE FGPNKGDPAE NASALKAEPW SVVIDGEVGK PGTYALEDFV KPYQLEERIY RLRCVEAWSM VIPWLGFPLA DLLKRVEPNG QAKFVRFETL QRPEQMVGQR SGFSVIDWPY MEGLRMDEAM HPLAILAVGM YGRLLPNQNG APLRLVVPWK YGFKSIKSIV RISLVREQPK TTWESIAANE YGFYANVNPQ VDHPRWSQAR ERRLPSGLFS PNVRDTQMFN GYGSEVASLY SGMDLRKYY. It is sometimes possible for the material contained within the vial of "Sulfoxide reductase catalytic subunit YedY (yedY), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual