Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Mitochondrial peptide methionine sulfoxide reductase isoform a Recombinant Protein | MSRA recombinant protein

Recombinant Human Mitochondrial peptide methionine sulfoxide reductase isoform a

Gene Names
MSRA; PMSR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial peptide methionine sulfoxide reductase isoform a; Recombinant Human Mitochondrial peptide methionine sulfoxide reductase isoform a; Peptide-methionine (S)-S-oxide reductase; Peptide Met(O) reductase; Protein-methionine-S-oxide reductase; PMSR; MSRA recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-235aa; Full Length
Sequence
GNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Sequence Length
195
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for MSRA recombinant protein
Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
Product Categories/Family for MSRA recombinant protein
References
Molecular cloning and functional expression of a human peptide methionine sulfoxide reductase (hMsrA) .Kuschel L., Hansel A., Schoenherr R., Weissbach H., Brot N., Hoshi T., Heinemann S.H.FEBS Lett. 456:17-21(1999) Heterogeneity and function of mammalian MSRs enzymes for repair, protection and regulation.Hansel A., Heinemann S.H., Hoshi T.Biochim. Biophys. Acta 1703:239-247(2005) Gene structure, localization and role in oxidative stress of methionine sulfoxide reductase A (MSRA) in the monkey retina.Lee J.W., Gordiyenko N.V., Marchetti M., Tserentsoodol N., Sagher D., Alam S., Weissbach H., Kantorow M., Rodriguez I.R.Exp. Eye Res. 82:816-827(2006) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Cloning of a novel human cDNA which shows great homology to Bos taurus methionine sulfoxide reductase (msrA) mRNA.Zhao Y., Yu L., Tu Q., Yue P., Zhang M., Zhao S.Y.A novel gene expressed in human hypothalamus.Peng Y., Huang C., Gu Y., Xu S., Han Z., Fu G., Chen Z. DNA sequence and analysis of human chromosome 8.Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T., Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.Nature 439:331-335(2006)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.9 kDa
NCBI Official Full Name
mitochondrial peptide methionine sulfoxide reductase isoform b
NCBI Official Synonym Full Names
methionine sulfoxide reductase A
NCBI Official Symbol
MSRA
NCBI Official Synonym Symbols
PMSR
NCBI Protein Information
mitochondrial peptide methionine sulfoxide reductase
UniProt Protein Name
Mitochondrial peptide methionine sulfoxide reductase
UniProt Gene Name
MSRA
UniProt Synonym Gene Names
Peptide Met(O) reductase; PMSR
UniProt Entry Name
MSRA_HUMAN

NCBI Description

This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein functions in the repair of oxidatively damaged proteins to restore biological activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

Uniprot Description

MSRA: Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine. Belongs to the MsrA Met sulfoxide reductase family. 5 isoforms of the human protein are produced by alternative promoter.

Protein type: EC 1.8.4.11; Oxidoreductase

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: actin cytoskeleton; cytoplasm; cytosol; membrane; mitochondrion; nucleoplasm

Molecular Function: peptide-methionine-(S)-S-oxide reductase activity

Biological Process: cellular protein metabolic process; methionine metabolic process; protein modification process; protein repair; response to oxidative stress

Research Articles on MSRA

Similar Products

Product Notes

The MSRA msra (Catalog #AAA1416492) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-235aa; Full Length. The amino acid sequence is listed below: GNSASNIVSP QEALPGRKEQ TPVAAKHHVN GNRTVEPFPE GTQMAVFGMG CFWGAERKFW VLKGVYSTQV GFAGGYTSNP TYKEVCSEKT GHAEVVRVVY QPEHMSFEEL LKVFWENHDP TQGMRQGNDH GTQYRSAIYP TSAKQMEAAL SSKENYQKVL SEHGFGPITT DIREGQTFYY AEDYHQQYLS KNPNGYCGLG GTGVSCPVGI KK. It is sometimes possible for the material contained within the vial of "Mitochondrial peptide methionine sulfoxide reductase isoform a, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.